SecReT4
Protein ID: 71907926
T4SS name [ID]Tra_F [598]
Gene symbol-
Locus tagDaro_2307
StrainDechloromonas aromatica RCB
Repliconchromosome [GenBank: NC_007298] [Browse all T4SS(s) in this replicon]
Location [Strand]2487750..2489657 [+]
Producthypothetical protein
Component typeTraD_F
UniProt IDQ47DN8
KEGG IDdar:Daro_2307
PDB IDNA
Domain hit(s) vs Pfam TrwB_AAD_bind [PF10412], Evalue: 1.1e-18, Aligned region: 167..203
TrwB_AAD_bind [PF10412], Evalue: 1.1e-18, Aligned region: 455..610
TraG-D_C [PF12696], Evalue: 3.5e-13, Aligned region: 474..599
AAA_10 [PF12846], Evalue: 3.7e-13, Aligned region: 169..553
Protein Sequence: 635 a.a.     [Download]
>gi|71907926|ref|YP_285513.1| hypothetical protein Daro_2307 [Dechloromonas aromatica RCB]
MLVRRYEMPWRRAYEVYAGIAWWLALLYFLGVGVVGALPLQLAMPLALVCFAMGVLRVTQALRMLVLRAS
LGGRGIEVVGTDDLARWCQDPALVFLGFGFEWQPVHSQRLYELSKVDYREFTVSPRLLQLLGYDSKPQPD
AEIGLPYIHGVEPKEGPLHRPLQNFEGGTLLVGTTQSGKGVALANLITQAIRRGDVVIVIDPKNSRRLKR
VVERACADYREPDTFMEFHPAFPERGVRLDFTFNWQKPTEIASRIQSIMPPDTAGAFSAFGWDAVNVVVQ
GLVEIEERPNLMKLTKYIEGGIEPVLEGSLRRYYDQTLGAGWRELPEMKKLLNDAHRGNLKRPSEAASAD
LMAFVAYYEHFIAQNQRNKVIDAQVRTFRHNREHYQKITANLLPILSMLTSGDLGRSLSPDPFDADDRRP
IMNFEKIERAGHVLYMCLDSLPDPSVASAIGALALADQAARAGMRYNLGGYRRIALFVDEVSNVINQPLI
EILNKGAEGGIFTTCAMQTLADLAKRLGSEDAARMALGNLNNLIALRTKDRPTQEFVVETFGKTAIHTVR
VGLSHGSDAHLGDFSSSYSTQLTESFEEMVPADVLGKLPNLQYFASVSGGRIIKGRFPILDPDAESCRAQ
GKATA
 
Nucleotide Sequence: 1908 bp     [Download]
>gi|71905642|ref|NC_007298.1|:2487750-2489657 Dechloromonas aromatica RCB, complete genome
ATGCTGGTACGCCGCTACGAGATGCCCTGGCGCCGCGCCTACGAGGTCTATGCCGGCATCGCCTGGTGGC
TGGCACTGCTCTATTTCCTGGGGGTAGGCGTAGTCGGCGCTCTCCCCCTTCAATTGGCCATGCCGCTGGC
ACTCGTCTGCTTCGCGATGGGCGTGCTGCGGGTGACCCAGGCCCTGCGCATGCTGGTCTTGCGGGCGTCG
CTGGGCGGGCGCGGCATCGAGGTCGTCGGTACCGACGACCTGGCTCGGTGGTGCCAGGATCCGGCCTTAG
TGTTCCTGGGCTTCGGCTTCGAATGGCAGCCCGTGCATTCGCAGCGGCTCTACGAACTGTCCAAGGTCGA
CTACCGGGAGTTCACCGTATCGCCGCGCCTGCTGCAACTTTTGGGCTACGACAGCAAGCCCCAGCCGGAC
GCCGAGATCGGTCTGCCCTATATCCACGGCGTCGAACCGAAGGAAGGCCCGTTGCACCGGCCGCTGCAGA
ACTTCGAGGGCGGCACACTGCTGGTAGGCACCACCCAGTCCGGCAAGGGGGTGGCACTCGCCAATCTGAT
CACCCAGGCGATCCGGCGCGGCGACGTGGTGATCGTCATCGATCCGAAGAACAGCCGGCGCCTGAAGCGG
GTTGTGGAGCGCGCCTGCGCGGACTACCGCGAGCCGGATACCTTCATGGAATTCCACCCTGCCTTTCCGG
AGCGGGGGGTACGGCTGGATTTCACCTTCAACTGGCAGAAGCCCACCGAGATCGCCTCGCGTATCCAGTC
GATCATGCCGCCGGACACGGCCGGCGCCTTCTCGGCCTTCGGCTGGGATGCCGTCAATGTCGTGGTCCAG
GGCCTGGTCGAGATCGAAGAACGGCCGAACCTGATGAAACTGACCAAGTACATCGAGGGCGGCATCGAGC
CGGTGCTGGAGGGGTCGCTGCGCCGCTACTACGACCAGACCCTCGGAGCGGGCTGGCGTGAACTGCCCGA
AATGAAGAAGCTGCTCAACGACGCCCATCGCGGCAACCTGAAGCGCCCGTCGGAGGCGGCCAGCGCCGAC
CTGATGGCCTTCGTCGCCTACTACGAGCACTTCATCGCCCAGAACCAGCGCAACAAGGTGATCGATGCCC
AGGTGCGCACCTTCCGCCACAACCGGGAGCATTACCAGAAGATCACCGCCAACCTGCTGCCCATCCTGTC
GATGCTGACCTCGGGCGACCTGGGGCGCAGCCTCTCGCCCGATCCCTTCGATGCGGACGACAGGCGGCCC
ATCATGAACTTCGAGAAAATCGAACGCGCCGGCCACGTGCTCTACATGTGCCTGGATTCCCTGCCCGATC
CGTCGGTCGCCTCGGCCATCGGCGCCCTGGCGCTGGCCGATCAGGCAGCGCGCGCCGGCATGCGCTACAA
CCTGGGCGGCTACCGACGCATCGCGCTGTTCGTCGACGAGGTCTCGAACGTCATCAACCAGCCGCTGATC
GAGATCCTCAACAAGGGCGCCGAGGGCGGCATCTTCACCACCTGCGCCATGCAGACCCTGGCGGACCTGG
CCAAGCGGCTGGGTAGCGAGGACGCGGCGCGCATGGCGCTGGGCAACCTCAACAACCTGATCGCGCTGCG
CACCAAGGACCGGCCGACCCAGGAATTCGTGGTCGAGACCTTCGGCAAGACGGCGATCCATACGGTGCGG
GTGGGCCTGAGCCACGGATCGGATGCCCACCTGGGCGACTTCTCGTCGAGCTATTCCACCCAACTCACCG
AGAGCTTTGAGGAGATGGTGCCAGCGGATGTGCTGGGCAAGCTGCCCAACCTCCAGTACTTCGCCTCGGT
GTCGGGCGGCCGGATCATCAAGGGACGGTTTCCGATCCTCGATCCCGATGCGGAGTCGTGCCGCGCCCAG
GGAAAGGCGACCGCATGA
 Primer design