SecReT4
Protein ID: 71907930
T4SS name [ID]Tra_F [598]
Gene symbol-
Locus tagDaro_2311
StrainDechloromonas aromatica RCB
Repliconchromosome [GenBank: NC_007298] [Browse all T4SS(s) in this replicon]
Location [Strand]2493743..2494294 [+]
Productlytic transglycosylase, catalytic
Component typeOrf169_F
UniProt IDQ47DN4
KEGG IDdar:Daro_2311
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 183 a.a.     [Download]
>gi|71907930|ref|YP_285517.1| lytic transglycosylase, catalytic [Dechloromonas aromatica RCB]
MRLPLNFAGLAALAVLATAPTWARACWEEAAQRYGISADLLYAVARVESNLNPQAVNRSHLQRTGSYDIG
LMQINSGHLSALSRHGIREIDLFEPCTNIQVGAWLLSDLFSRQGATWDTVGTYNAACSQLKGEACSKARA
QYAWRVYRQLSALHSNQLAGVTKKGKQTPQGETLPPISVRVAP
 
Nucleotide Sequence: 552 bp     [Download]
>gi|71905642|ref|NC_007298.1|:2493743-2494294 Dechloromonas aromatica RCB, complete genome
ATGCGTCTGCCGCTGAACTTTGCTGGTCTTGCTGCACTGGCCGTCCTGGCGACCGCGCCCACCTGGGCGC
GGGCTTGCTGGGAGGAAGCTGCCCAGCGCTACGGCATTTCGGCCGACCTGCTCTATGCCGTTGCCCGGGT
CGAGTCGAACCTGAACCCCCAGGCCGTCAACCGCTCGCACCTCCAGCGTACCGGCTCCTACGACATCGGC
CTCATGCAGATCAACAGCGGCCATCTTTCAGCCCTATCACGCCACGGCATTCGGGAAATCGATCTCTTCG
AGCCATGCACCAATATCCAGGTCGGCGCCTGGCTGCTGTCCGACCTATTCTCCCGGCAGGGCGCGACGTG
GGATACGGTCGGTACCTACAATGCCGCCTGCTCGCAGCTCAAGGGTGAAGCCTGCTCCAAAGCCCGCGCC
CAATACGCTTGGCGGGTGTATCGCCAGTTGTCCGCGCTACATAGCAACCAACTTGCCGGTGTAACAAAGA
AGGGCAAACAGACACCCCAAGGCGAAACATTGCCCCCCATATCGGTAAGGGTAGCGCCATGA
 Primer design