SecReT4
Protein ID: 71907933
T4SS name [ID]Tra_F [598]
Gene symbol-
Locus tagDaro_2314
StrainDechloromonas aromatica RCB
Repliconchromosome [GenBank: NC_007298] [Browse all T4SS(s) in this replicon]
Location [Strand]2495481..2495780 [+]
Producthypothetical protein
Component typeTraL_F
UniProt IDQ47CQ4
KEGG IDdar:Daro_2314, dar:Daro_2647
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 2.7e-32, Aligned region: 5..99
Protein Sequence: 99 a.a.     [Download]
>gi|71907933|ref|YP_285520.1| hypothetical protein Daro_2314 [Dechloromonas aromatica RCB]
MQADTYIPRRLDDQWKIGFWDVDVAAPILFMFFVGYMSGSKTSFAVCMAAGIFVSRWISRIKADKHPAFA
IHWLYWHLPASPLTTMRATPPSHIRRMVG
 
Nucleotide Sequence: 300 bp     [Download]
>gi|71905642|ref|NC_007298.1|:2495481-2495780 Dechloromonas aromatica RCB, complete genome
ATGCAAGCAGACACCTATATTCCGCGGCGTCTTGATGATCAATGGAAGATCGGCTTCTGGGATGTCGATG
TCGCCGCACCGATCCTGTTCATGTTTTTCGTTGGCTATATGTCTGGCAGCAAGACCTCGTTCGCCGTATG
TATGGCAGCGGGCATCTTCGTCTCACGCTGGATCTCGCGCATCAAGGCGGACAAGCATCCGGCCTTTGCC
ATCCACTGGCTGTACTGGCACTTGCCGGCCAGTCCGTTGACCACGATGCGCGCCACGCCGCCGTCGCACA
TCCGCCGCATGGTCGGCTAA
 Primer design