SecReT4
Protein ID: 71907934
T4SS name [ID]Tra_F [598]
Gene symbol-
Locus tagDaro_2315
StrainDechloromonas aromatica RCB
Repliconchromosome [GenBank: NC_007298] [Browse all T4SS(s) in this replicon]
Location [Strand]2495798..2496364 [+]
Productplasmid-like conjugative transfer protein TraE
Component typeTraE_F
UniProt IDQ47DN0
KEGG IDdar:Daro_2315
PDB IDNA
Domain hit(s) vs Pfam TraE [PF05309], Evalue: 2.8e-34, Aligned region: 1..185
Protein Sequence: 188 a.a.     [Download]
>gi|71907934|ref|YP_285521.1| plasmid-like conjugative transfer protein TraE [Dechloromonas aromatica RCB]
MDFERLNGDIKEMRRRNRGLGLAVGVLAAGQILALIVILNLLGTVRTVVVPPSIDKTFWVTRDKASNEYL
EQMGSFIAWLVLDVTPASIDWKKEILLGYVEPEQYGPLKTRQEVEAERLKRINAATVFAPQQLVPSEEGQ
SVVIRGRLRTVVNGFETANDLKAYRVEFNYAGARMHLKSFKEVANVGN
 
Nucleotide Sequence: 567 bp     [Download]
>gi|71905642|ref|NC_007298.1|:2495798-2496364 Dechloromonas aromatica RCB, complete genome
ATGGACTTCGAACGACTCAACGGCGACATCAAGGAAATGCGCCGCCGCAACCGCGGGCTCGGTCTGGCCG
TCGGTGTCCTAGCCGCCGGCCAGATCCTCGCTCTGATAGTCATCCTCAACCTGCTCGGCACGGTGCGTAC
CGTCGTCGTGCCACCCTCGATCGACAAGACCTTCTGGGTCACCCGCGACAAGGCCAGCAACGAGTACCTC
GAGCAGATGGGCAGTTTCATCGCCTGGCTTGTCCTTGATGTGACGCCGGCCTCGATCGACTGGAAGAAGG
AAATTCTGCTCGGCTACGTCGAACCGGAACAGTACGGCCCGCTGAAGACCCGACAGGAAGTCGAAGCCGA
ACGCCTGAAGCGCATCAACGCCGCCACCGTCTTCGCGCCCCAGCAACTGGTCCCCAGTGAAGAAGGCCAG
AGCGTCGTCATTCGCGGCCGCCTGCGCACCGTGGTCAATGGCTTCGAGACGGCTAACGACCTCAAGGCCT
ATCGGGTCGAGTTCAACTACGCCGGCGCGCGCATGCATCTGAAAAGTTTCAAGGAGGTAGCCAATGTCGG
CAACTGA
 Primer design