SecReT4
Protein ID: 71907935
T4SS name [ID]Tra_F [598]
Gene symbol-
Locus tagDaro_2316
StrainDechloromonas aromatica RCB
Repliconchromosome [GenBank: NC_007298] [Browse all T4SS(s) in this replicon]
Location [Strand]2496351..2497226 [+]
Producthypothetical protein
Component typeTraK_F
UniProt IDQ47DM9
KEGG IDdar:Daro_2316
PDB IDNA
Domain hit(s) vs Pfam TraK [PF06586], Evalue: 1e-25, Aligned region: 25..284
Protein Sequence: 291 a.a.     [Download]
>gi|71907935|ref|YP_285522.1| hypothetical protein Daro_2316 [Dechloromonas aromatica RCB]
MSATDTHPALSRSDSKPASKHGRTMSAVLAIACVASMTALPAQALQLVEASDGAAVEAILSIREPTRIRI
EGAAITDVFGNIHSSQCGMAAALPASPGMTPAGMGSSPINPAGEIALTCDRDKGEIYVRPVGDSTKPINL
FVASANATYTLLLRRSDTPADTIVIRDRTPKALQHAPSAPAGPSPNQVRAMKALLVAMASDRVPPDIRVE
ETHGTLPLWNEARFSRVRQYEGRSLVGEKYLLQNISDAPMVLAEPEFDRERDSVVGIAVEHHNLRPSEST
SVYVIRRGETP
 
Nucleotide Sequence: 876 bp     [Download]
>gi|71905642|ref|NC_007298.1|:2496351-2497226 Dechloromonas aromatica RCB, complete genome
ATGTCGGCAACTGATACCCACCCGGCCCTATCCAGATCCGATTCCAAGCCGGCGTCGAAACACGGACGGA
CGATGAGCGCTGTTCTGGCCATCGCCTGTGTCGCCAGCATGACTGCCCTGCCCGCTCAGGCACTGCAACT
CGTCGAGGCCAGTGACGGCGCGGCGGTCGAAGCCATCCTGTCAATCCGCGAACCGACCCGCATCCGCATC
GAAGGGGCAGCGATCACCGATGTCTTTGGCAATATCCATTCGAGCCAATGCGGCATGGCGGCGGCGCTTC
CCGCTAGCCCGGGCATGACGCCCGCCGGTATGGGTTCATCACCGATCAATCCAGCCGGCGAGATTGCCCT
GACCTGCGACCGCGACAAGGGCGAAATCTATGTCCGTCCAGTTGGTGATTCCACCAAACCGATCAATCTC
TTCGTCGCATCGGCCAACGCCACCTATACCTTGCTGCTGCGCCGTTCGGATACCCCGGCCGACACGATCG
TCATCCGCGACAGGACACCGAAGGCCTTGCAGCATGCGCCATCAGCCCCGGCCGGACCCTCACCCAATCA
GGTACGAGCCATGAAAGCGCTGTTGGTGGCGATGGCTTCAGATCGGGTACCGCCGGATATCCGAGTCGAA
GAGACCCACGGCACGCTTCCGTTATGGAACGAGGCGCGGTTTTCGCGGGTGCGTCAGTACGAGGGGCGCA
GCCTGGTTGGCGAGAAATACCTGCTGCAGAACATCAGCGATGCCCCCATGGTGCTGGCCGAACCGGAATT
CGACCGCGAACGGGACAGCGTCGTCGGCATTGCCGTCGAGCACCACAACCTTCGCCCTAGCGAGAGCACC
AGCGTCTATGTGATCCGCCGCGGAGAAACGCCATGA
 Primer design