SecReT4
Protein ID: 71907936
T4SS name [ID]Tra_F [598]
Gene symbol-
Locus tagDaro_2317
StrainDechloromonas aromatica RCB
Repliconchromosome [GenBank: NC_007298] [Browse all T4SS(s) in this replicon]
Location [Strand]2497223..2498593 [+]
ProductTraB pilus assembly
Component typeTraB_F
UniProt IDQ47DM8
KEGG IDdar:Daro_2317
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 1.7e-45, Aligned region: 230..424
Protein Sequence: 456 a.a.     [Download]
>gi|71907936|ref|YP_285523.1| TraB pilus assembly [Dechloromonas aromatica RCB]
MTTPRQWMQTLRGLPQQLLQHLSPRQRQYAMLGALLVGGVGLLWTIFAFTASSPPAISTQPATGPASSVT
NIGVMSPGAQVNPVDQWVGTAGRKLAQYENEREEQGRLNKDRQTFEAKTMQRFAELEQRLTSTQQAVATP
MPPTPVPTMPPAASLPPAPPPSKGLSTGAMPSGTPGDLLPPSPLIAQTPAITRITVAERSLLASPGEKAE
RAAGAGSQNPRTVSTFLPVSFTRGTLLGGLDAPTGGQSQSNPHPVLIRLSDNSFLPNRFRAEYRECFVVA
AGYGDISSERAYLRTESLSCVRTDGATLEVKIQGSIYGEDGKVGMRGRLVTKQGQMLANALLAGVVSGIG
QGLATSSTEYSTSALGTVASATGSEAYRAGLGSGVGKALDRLAQYYIKLAENTFPVIEVDAGREVDVVIT
KGVRIDVPMTSGEPPSARFANSPETRYLETSDDGNY
 
Nucleotide Sequence: 1371 bp     [Download]
>gi|71905642|ref|NC_007298.1|:2497223-2498593 Dechloromonas aromatica RCB, complete genome
ATGACGACGCCGCGTCAGTGGATGCAAACGCTGCGGGGCTTACCGCAGCAATTACTGCAGCACCTCTCCC
CGCGGCAACGCCAGTACGCCATGCTTGGCGCCCTGCTGGTCGGTGGCGTCGGGCTGCTCTGGACGATTTT
TGCATTCACGGCGAGCAGTCCGCCAGCGATCAGCACGCAACCCGCCACCGGGCCAGCCAGTTCGGTCACC
AACATCGGCGTGATGTCGCCTGGCGCTCAGGTCAATCCGGTCGATCAGTGGGTCGGCACAGCCGGCCGCA
AGCTTGCCCAGTACGAGAACGAACGCGAAGAACAGGGACGACTCAACAAGGATCGCCAGACCTTCGAAGC
TAAGACGATGCAACGCTTTGCCGAACTGGAACAGCGACTGACGTCGACCCAGCAGGCAGTTGCGACGCCC
ATGCCTCCCACGCCAGTCCCGACCATGCCACCGGCGGCGAGTCTGCCCCCTGCTCCGCCACCCTCCAAGG
GCTTGTCCACTGGGGCAATGCCGAGCGGCACGCCCGGCGACCTGCTGCCTCCGAGCCCGCTGATTGCGCA
AACGCCAGCGATCACCCGGATTACGGTGGCCGAGCGCTCCCTGCTCGCCAGCCCGGGAGAGAAAGCCGAG
CGCGCCGCCGGGGCTGGATCACAAAACCCCCGAACCGTATCCACCTTCCTGCCCGTCAGCTTTACCCGTG
GCACGCTGCTGGGGGGACTGGATGCGCCGACCGGTGGGCAATCGCAATCCAATCCGCACCCGGTCCTGAT
CCGTCTTTCAGACAACTCCTTCCTGCCCAACCGCTTCCGCGCCGAATACCGGGAGTGCTTCGTGGTAGCC
GCCGGCTATGGCGACATCAGTTCCGAGCGTGCCTATCTGCGGACCGAAAGTCTGTCTTGCGTACGAACCG
ACGGCGCGACGCTGGAAGTCAAGATTCAGGGTTCGATCTACGGCGAGGATGGCAAGGTCGGCATGCGCGG
GCGACTGGTCACCAAGCAGGGCCAAATGCTCGCCAACGCCCTGCTAGCCGGTGTGGTCAGCGGCATCGGC
CAGGGCCTGGCCACCTCGTCGACCGAGTACAGCACCTCAGCTCTCGGTACAGTCGCCAGTGCCACCGGAT
CCGAAGCCTATCGCGCCGGCCTCGGCTCGGGTGTCGGCAAGGCCCTCGACCGGCTGGCCCAGTACTACAT
CAAGCTCGCCGAGAACACCTTTCCGGTCATCGAAGTGGACGCCGGTCGCGAAGTCGACGTGGTGATCACC
AAGGGCGTGCGCATCGATGTGCCGATGACAAGCGGCGAACCGCCTTCCGCCCGCTTCGCCAATTCCCCTG
AAACCCGTTATCTGGAGACCTCGGACGATGGCAACTACTAA
 Primer design