SecReT4
Protein ID: 71907938
T4SS name [ID]Tra_F [598]
Gene symbol-
Locus tagDaro_2319
StrainDechloromonas aromatica RCB
Repliconchromosome [GenBank: NC_007298] [Browse all T4SS(s) in this replicon]
Location [Strand]2499395..2499976 [+]
Producthypothetical protein
Component typeTraV_F
UniProt IDQ47DM6
KEGG IDdar:Daro_2319
PDB IDNA
Domain hit(s) vs Pfam TraV [PF09676], Evalue: 1.2e-27, Aligned region: 30..138
Protein Sequence: 193 a.a.     [Download]
>gi|71907938|ref|YP_285525.1| hypothetical protein Daro_2319 [Dechloromonas aromatica RCB]
MKTLVLRMVAVCLFLPLAACMNMSGLGGDSKYACKAPDGVACDSVSGTYANALHNNLPSQQAQRFARRQK
ELSEEIPSPTLGRTTSSAAANASGMAVTPAPLRTQARILRLWIKPWEDADGDLYDQGYVYVQVDNGQWQI
DHVQRQIRDLYAPLKPPPKPDTEAANEPGANTPPPLPMLQRPPLSGAGANPAH
 
Nucleotide Sequence: 582 bp     [Download]
>gi|71905642|ref|NC_007298.1|:2499395-2499976 Dechloromonas aromatica RCB, complete genome
ATGAAGACGCTCGTCCTGCGAATGGTTGCAGTCTGCCTATTCCTCCCCTTGGCCGCCTGCATGAACATGT
CCGGCCTGGGCGGCGACTCGAAGTACGCCTGCAAGGCCCCCGATGGCGTCGCCTGCGACTCGGTGTCGGG
CACCTACGCCAACGCCCTACACAACAATCTGCCCAGCCAGCAGGCACAACGATTCGCTCGCCGACAGAAA
GAGCTATCCGAAGAAATCCCCTCCCCGACGCTTGGACGTACCACCTCATCGGCAGCAGCCAACGCTTCCG
GCATGGCCGTAACGCCCGCCCCCCTGCGAACCCAGGCCCGTATCCTGCGGCTGTGGATCAAACCCTGGGA
AGACGCCGACGGCGATCTCTACGATCAGGGCTACGTCTATGTCCAGGTGGACAACGGCCAGTGGCAGATC
GACCACGTGCAACGCCAGATCCGTGATCTCTATGCGCCGCTGAAGCCCCCGCCCAAGCCGGACACTGAGG
CAGCAAACGAACCCGGCGCCAATACACCGCCGCCCCTACCGATGTTGCAACGCCCGCCGCTGTCCGGGGC
CGGCGCCAACCCTGCGCATTGA
 Primer design