SecReT4
Protein ID: 71907939
T4SS name [ID]Tra_F [598]
Gene symbol-
Locus tagDaro_2320
StrainDechloromonas aromatica RCB
Repliconchromosome [GenBank: NC_007298] [Browse all T4SS(s) in this replicon]
Location [Strand]2499984..2502551 [+]
Producthypothetical protein
Component typeTraC_F
UniProt IDQ47DM5
KEGG IDdar:Daro_2320
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 2.1e-68, Aligned region: 32..282
AAA_10 [PF12846], Evalue: 1.4e-46, Aligned region: 480..770
FtsK_SpoIIIE [PF01580], Evalue: 1.7e-05, Aligned region: 451..517
Protein Sequence: 855 a.a.     [Download]
>gi|71907939|ref|YP_285526.1| hypothetical protein Daro_2320 [Dechloromonas aromatica RCB]
MNTAHGDPHFIGQRDHAHAPRFPFGEPADTPAEQFANWLPYSGYLAAEKIFVNRDSMGVMLELMPQSGAD
ERMAEVLISLYANCPPGTGIQFHLFASPQVRSQLRQYANLRVEDEDQAEQAKQWGRPARNGNLFRKLARQ
RVEHLLQGAQKSLTAGFHYTIRDFRLMLSVAFPGDPEDLNKRDELLALRDSMSSSLRSASLPNRVCDAAD
LINWCALFTNPDRISQTDAPDLNYDDGRELRDQIVDFDTIQDPHPSGLTLWKEASPDVLEARFYSIKSFP
ERFALWQMGSLIGDLMQPALQYSAPFLLTLGVQILDPNLTKSVVTANHVRATQNAKSKMADVMPDVNKKL
QDWTAAADAIDTGGNLVSLYHQLAIFTAPNKSVAAHEAANAIWRGRGFQLNADAYMHRQALLASLPMTLT
EKFHKDLVKMRRVTRKTMANAIHMAPLIAEWRGTRTPALVFGGRRGQLMTLDIFDNDLGNYNFAIIGAPG
SGKSVLMNEMAWSYRAIGAKVWMLDLGRSFEKLCRKAKGTYIEFRPDVNICLDPFTHIVDINEDIDMLVP
GISKMCSMQHTLEEVQYKAISAMVLKLWREYGNELRITGLRDAFKSGSIEELGIVGDQRIKDLAIMLNPY
SRGGQYERFFEGQNNIDFSNDFIVIENEELKRRPDLHAVVNILLLHRITGEMYLTRNRRKVLFVDELKQQ
LGDIGADDPVKAAVIEEAARRARKYGGALGTATQSADDFYGSTQMEAAFNCSDWVFLLRQKPESIEMLDR
KGRLTMDEPKKRLLNSLRTEAGVFSELYISSPVGEGVARNILDPATHLLFSNKLEDNAPIDELRAQGLSI
DEAISELLRHRGHAV
 
Nucleotide Sequence: 2568 bp     [Download]
>gi|71905642|ref|NC_007298.1|:2499984-2502551 Dechloromonas aromatica RCB, complete genome
ATGAACACCGCCCACGGCGATCCCCATTTCATTGGTCAGCGCGACCACGCCCATGCGCCGCGCTTTCCCT
TTGGCGAGCCGGCGGACACACCGGCTGAACAGTTCGCCAACTGGCTGCCCTACTCTGGCTATCTCGCCGC
CGAGAAGATTTTCGTGAACCGCGACAGCATGGGCGTCATGCTCGAATTGATGCCGCAGTCGGGCGCCGAC
GAGCGGATGGCGGAAGTGCTGATTTCGCTCTACGCCAATTGCCCGCCCGGCACCGGTATCCAGTTCCATC
TGTTCGCCTCGCCGCAGGTGCGCAGCCAGTTGCGCCAGTACGCCAATCTGCGGGTCGAGGATGAGGATCA
GGCCGAGCAGGCCAAACAGTGGGGCCGTCCGGCACGCAACGGAAATCTGTTCCGCAAATTGGCCAGGCAG
CGCGTCGAGCACCTGCTGCAGGGGGCACAGAAGTCGCTGACCGCCGGTTTCCACTACACGATCCGGGATT
TTCGGCTGATGCTGAGCGTCGCCTTTCCGGGCGACCCGGAAGACCTCAACAAACGCGACGAACTGCTCGC
CCTGCGCGACTCGATGTCGTCCAGCCTGCGCTCAGCCTCGCTGCCCAATCGCGTTTGTGATGCCGCCGAC
CTGATCAACTGGTGTGCGCTGTTCACCAATCCCGACCGCATCTCCCAAACCGATGCGCCGGACCTCAACT
ACGATGATGGTCGAGAACTGCGCGACCAGATCGTCGACTTCGACACCATCCAGGACCCGCATCCGAGTGG
CCTGACCTTGTGGAAGGAAGCCAGTCCCGATGTATTAGAGGCGCGCTTCTACTCGATCAAGAGTTTCCCC
GAGCGCTTTGCCCTGTGGCAGATGGGGTCGCTGATCGGCGACCTGATGCAGCCGGCCTTGCAGTACAGCG
CACCGTTTCTGCTCACCCTCGGCGTCCAGATTCTCGACCCCAACCTCACCAAGTCGGTGGTCACCGCCAA
CCATGTGCGGGCGACGCAAAACGCCAAATCGAAGATGGCTGACGTCATGCCGGACGTCAACAAGAAGCTG
CAGGACTGGACGGCCGCGGCCGATGCCATCGACACCGGCGGCAATCTGGTCAGCCTGTACCACCAGTTGG
CGATATTCACCGCACCCAACAAATCGGTCGCCGCTCACGAAGCGGCCAATGCGATCTGGCGCGGCCGGGG
TTTCCAGCTCAATGCCGACGCCTACATGCACCGCCAGGCACTGCTCGCCAGCCTGCCGATGACGCTGACC
GAGAAGTTCCACAAGGACTTGGTCAAAATGCGCCGGGTCACGCGCAAGACCATGGCCAACGCCATCCACA
TGGCGCCGCTGATCGCCGAGTGGCGCGGCACGCGCACCCCGGCCCTAGTGTTTGGGGGACGGCGGGGGCA
GTTGATGACGCTCGATATCTTCGACAACGATCTCGGCAACTACAACTTCGCCATCATCGGTGCCCCCGGC
TCGGGCAAGTCGGTACTGATGAACGAAATGGCCTGGTCCTACCGCGCCATCGGCGCCAAGGTCTGGATGC
TCGATCTTGGTCGCAGCTTCGAGAAGCTGTGCCGCAAGGCCAAGGGCACCTATATCGAGTTCCGGCCCGA
CGTGAATATCTGCCTGGATCCGTTCACCCACATCGTCGACATTAATGAAGACATCGACATGCTGGTACCC
GGCATTTCCAAGATGTGCTCGATGCAGCACACCCTGGAAGAGGTTCAGTACAAGGCCATCTCGGCCATGG
TCCTCAAGCTCTGGCGCGAATACGGCAACGAACTGCGCATCACCGGGCTACGCGATGCCTTCAAGAGCGG
GAGCATCGAAGAACTAGGCATCGTTGGCGACCAGCGCATCAAGGACCTCGCCATCATGCTCAACCCCTAC
TCGCGTGGCGGGCAATACGAACGCTTCTTCGAAGGCCAGAACAACATCGACTTTTCCAATGACTTCATCG
TCATCGAGAACGAGGAACTGAAACGCCGGCCCGACCTGCATGCCGTCGTCAATATTCTGCTGCTCCATCG
GATCACCGGCGAGATGTACCTCACGCGCAACCGGCGCAAGGTACTTTTCGTCGACGAGTTGAAACAGCAA
CTGGGCGACATCGGTGCCGACGACCCGGTCAAGGCTGCCGTGATCGAGGAAGCGGCCCGGCGTGCCCGCA
AGTACGGCGGTGCGCTCGGCACTGCGACCCAGAGTGCCGACGACTTCTACGGCTCGACCCAGATGGAAGC
GGCCTTCAACTGCTCAGACTGGGTCTTCCTGCTGCGTCAGAAGCCCGAATCCATCGAAATGCTCGACCGC
AAGGGCCGGCTGACCATGGATGAACCGAAGAAACGCCTGCTCAATTCCCTGCGCACCGAGGCCGGCGTCT
TCTCCGAGTTGTACATCTCGTCGCCGGTCGGCGAAGGCGTCGCCCGCAACATCCTCGATCCGGCCACCCA
CCTGTTGTTCTCCAACAAGTTGGAAGACAACGCCCCGATCGATGAATTGCGCGCCCAGGGCCTATCCATC
GACGAGGCGATCAGCGAACTGCTGCGCCATCGGGGGCACGCGGTATGA
 Primer design