SecReT4
Protein ID: 71907943
T4SS name [ID]Tra_F [598]
Gene symbol-
Locus tagDaro_2324
StrainDechloromonas aromatica RCB
Repliconchromosome [GenBank: NC_007298] [Browse all T4SS(s) in this replicon]
Location [Strand]2503885..2504520 [+]
Producthypothetical protein
Component typeTraW_F
UniProt IDQ47DM1
KEGG IDdar:Daro_2324
PDB IDNA
Domain hit(s) vs Pfam TraW_N [PF12477], Evalue: 7.6e-11, Aligned region: 7..36
Protein Sequence: 211 a.a.     [Download]
>gi|71907943|ref|YP_285530.1| hypothetical protein Daro_2324 [Dechloromonas aromatica RCB]
MKRLIAIPLVLFALLLAAPGARAIDLGVIGPTYEISEPHLLQMIEQRLRDKERSGELKRREEQARERGIA
TVKNPPPVAGLHSTETARTYYFDPSFTLDRNILGPRGELLFAAGTRKNPLEVVSLSRHLLFFDGRDARQV
GRARQLIAFYQGRVKPILVGGSYLELMKSWRMPVYFDQQGLLTRRFGITQVPALVSQEGLRLRIDELEIA
P
 
Nucleotide Sequence: 636 bp     [Download]
>gi|71905642|ref|NC_007298.1|:2503885-2504520 Dechloromonas aromatica RCB, complete genome
ATGAAACGCCTGATCGCCATCCCGCTCGTTCTCTTCGCGCTGCTGCTGGCCGCACCGGGCGCGCGGGCCA
TTGATCTGGGCGTCATCGGGCCGACCTACGAGATCAGCGAACCGCATCTGCTGCAGATGATCGAACAGCG
CCTGCGCGACAAGGAACGCAGCGGCGAACTCAAGCGCCGGGAAGAACAGGCCCGGGAACGCGGCATCGCA
ACCGTCAAAAACCCGCCACCGGTTGCCGGCCTGCACTCGACCGAAACAGCCCGAACCTACTACTTCGACC
CGAGCTTCACGCTAGATCGCAACATCCTCGGCCCGCGAGGCGAGTTGCTGTTTGCCGCCGGCACCCGCAA
GAACCCGCTGGAGGTGGTGTCGCTGTCCCGACACCTGCTCTTTTTCGATGGGCGCGACGCGCGTCAGGTC
GGCCGTGCCCGGCAGTTGATCGCCTTCTACCAGGGGCGGGTTAAGCCGATCCTGGTCGGCGGTTCCTACC
TCGAACTGATGAAGTCATGGCGCATGCCGGTCTATTTCGATCAGCAGGGTCTGCTCACCCGTCGCTTCGG
CATCACTCAGGTACCGGCCCTGGTATCGCAGGAAGGATTGCGCCTACGCATCGACGAACTGGAGATCGCG
CCATGA
 Primer design

Protein ID: 71907945
T4SS name [ID]Tra_F [598]
Gene symbol-
Locus tagDaro_2326
StrainDechloromonas aromatica RCB
Repliconchromosome [GenBank: NC_007298] [Browse all T4SS(s) in this replicon]
Location [Strand]2505532..2506290 [+]
Producthypothetical protein
Component typeTraW_F
UniProt IDQ47DL9
KEGG IDdar:Daro_2326
PDB IDNA
Domain hit(s) vs Pfam TrbC_Ftype [PF09673], Evalue: 9.2e-32, Aligned region: 121..233
Protein Sequence: 252 a.a.     [Download]
>gi|71907945|ref|YP_285532.1| hypothetical protein Daro_2326 [Dechloromonas aromatica RCB]
MSATNLQRTLVTMILGLSAALVAGSSAQAQISPVVIEADIERARRETPTVTEQDIELARQKYALPGDAGQ
RLAPLNSPNIEALPKPATQIPVDLEALARGYAGQSDAMAQAQGLTAGPGLFLFVSLTMPRATLQGLVDQA
ARAKATIVIRGFANGSLRDTVALVQGLIGKRQVAIQIDPLAFDRFAISKVPSFVLVRDGTRPVVCASGSC
ASADSFLRSTGDVSLDYALEHMQRSAPAFAPAAELFLKRIRG
 
Nucleotide Sequence: 759 bp     [Download]
>gi|71905642|ref|NC_007298.1|:2505532-2506290 Dechloromonas aromatica RCB, complete genome
GTGTCGGCTACTAACCTCCAACGAACCCTCGTCACCATGATCCTCGGTCTCAGCGCCGCACTCGTTGCCG
GCAGTTCGGCCCAGGCCCAGATTTCGCCGGTCGTCATAGAGGCGGACATCGAACGCGCCCGGCGCGAGAC
CCCCACCGTCACCGAGCAAGATATCGAGTTGGCGCGGCAGAAGTACGCCCTGCCGGGTGATGCCGGACAA
CGGCTCGCCCCGCTGAACAGCCCGAATATCGAGGCGCTACCCAAGCCGGCAACGCAGATACCGGTCGATC
TGGAAGCGCTGGCTCGCGGCTATGCCGGGCAATCCGATGCGATGGCTCAGGCGCAGGGGCTCACTGCCGG
GCCAGGACTTTTCCTCTTCGTCAGCCTGACCATGCCCCGCGCCACGCTGCAAGGTCTGGTCGACCAGGCG
GCACGGGCCAAGGCCACCATCGTCATCCGCGGCTTTGCCAACGGTTCGCTGCGCGACACGGTTGCCCTGG
TCCAGGGCTTGATCGGCAAACGGCAGGTAGCAATCCAGATCGATCCGCTGGCCTTCGACCGGTTCGCCAT
CAGCAAGGTACCCAGCTTTGTCCTGGTGCGTGACGGTACACGTCCCGTCGTCTGCGCCAGCGGCAGTTGC
GCCTCCGCCGACAGTTTCCTGCGATCAACTGGTGACGTCAGCCTGGATTACGCGCTGGAACACATGCAGC
GCTCGGCGCCTGCCTTTGCTCCAGCCGCCGAACTCTTCCTGAAACGCATCAGAGGATAG
 Primer design