SecReT4
Protein ID: 71907944
T4SS name [ID]Tra_F [598]
Gene symbol-
Locus tagDaro_2325
StrainDechloromonas aromatica RCB
Repliconchromosome [GenBank: NC_007298] [Browse all T4SS(s) in this replicon]
Location [Strand]2504517..2505545 [+]
Producthypothetical protein
Component typeTraU_F
UniProt IDQ47DM0
KEGG IDdar:Daro_2325
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 6e-78, Aligned region: 36..340
Protein Sequence: 342 a.a.     [Download]
>gi|71907944|ref|YP_285531.1| hypothetical protein Daro_2325 [Dechloromonas aromatica RCB]
MSQRCFLNSLPILLALLLGFSTLPTQAAGTATCTGKFPNPITDICWSCILPISIGSARIANFGDQEDTDN
PPNPVCSCLVNPIVGLSIGFWEPARHVEVVRKPFCLVSLGGVDLDPGIPAPEAARFTRPEGDGDGGGFYQ
AHYYLNPVMYWLEVVTDFPCLEKSSFDLAYMTEVDPLWADDELTLILNPDAVLFANPVAIAACAADCVAA
SVGFGIRELFWCAGCQGGVYPLNGHVPYHLGGVRTAALMAQRLSAKMHRELVAWGWHGKDGLCGPYFEPV
MDKTAYKTQLTYPIPNTDKEGGRCCQPFGRTTVLWGAGKEYPVRGEDFAFMLFRKRNCCVGY
 
Nucleotide Sequence: 1029 bp     [Download]
>gi|71905642|ref|NC_007298.1|:2504517-2505545 Dechloromonas aromatica RCB, complete genome
ATGAGCCAACGCTGCTTCCTAAACAGCCTCCCTATCCTTCTGGCACTGCTCCTCGGTTTCTCCACCCTGC
CGACCCAGGCCGCCGGCACCGCCACCTGCACCGGCAAGTTTCCGAATCCGATCACAGATATTTGCTGGTC
CTGCATCCTGCCGATCAGCATTGGCAGTGCGCGCATAGCCAACTTCGGCGACCAGGAGGATACCGACAAT
CCACCCAATCCTGTCTGCAGTTGCCTGGTCAATCCGATCGTCGGTCTGTCCATCGGTTTCTGGGAACCGG
CGCGCCATGTCGAAGTGGTGCGCAAACCCTTCTGCCTCGTCTCGCTCGGCGGCGTCGACCTCGATCCGGG
CATCCCGGCCCCCGAGGCAGCCCGCTTTACCCGTCCGGAAGGCGATGGCGACGGTGGCGGTTTCTATCAG
GCGCATTACTACTTGAACCCGGTGATGTACTGGCTGGAAGTAGTCACCGACTTTCCCTGCCTGGAGAAGA
GTTCCTTCGATCTGGCCTACATGACCGAAGTCGATCCCTTGTGGGCCGACGACGAACTCACCCTGATCCT
CAATCCCGATGCCGTACTGTTTGCCAATCCGGTCGCCATTGCCGCGTGCGCCGCCGATTGCGTGGCGGCC
TCAGTCGGCTTCGGCATACGCGAGCTGTTCTGGTGCGCCGGTTGTCAGGGCGGCGTCTATCCCCTTAACG
GTCACGTCCCCTACCACCTCGGTGGCGTGCGGACTGCCGCGCTGATGGCCCAGCGCTTGAGCGCCAAGAT
GCACCGCGAGTTGGTGGCTTGGGGCTGGCATGGCAAAGACGGCCTGTGCGGTCCGTACTTCGAGCCGGTG
ATGGACAAGACCGCCTACAAAACCCAACTCACCTATCCCATTCCCAACACCGACAAGGAAGGCGGCCGCT
GCTGCCAGCCCTTCGGGCGGACCACCGTGCTCTGGGGTGCCGGCAAGGAATACCCGGTCCGCGGCGAGGA
CTTTGCCTTCATGTTGTTTCGCAAAAGGAATTGCTGTGTCGGCTACTAA
 Primer design