SecReT4
Protein ID: 71907946
T4SS name [ID]Tra_F [598]
Gene symbol-
Locus tagDaro_2327
StrainDechloromonas aromatica RCB
Repliconchromosome [GenBank: NC_007298] [Browse all T4SS(s) in this replicon]
Location [Strand]2506291..2508405 [+]
Productconjugal transfer mating pair stabilization protein TraN
Component typeTraN_F
UniProt IDQ47DL8
KEGG IDdar:Daro_2327
PDB IDNA
Domain hit(s) vs Pfam TraN [PF06986], Evalue: 2.1e-44, Aligned region: 318..483
TraN [PF06986], Evalue: 2.1e-44, Aligned region: 572..654
Protein Sequence: 704 a.a.     [Download]
>gi|71907946|ref|YP_285533.1| conjugal transfer mating pair stabilization protein TraN [Dechloromonas aromatica RCB]
MIAMRRLIIWITLFCFITTQSAAIAGPFEEGTAAGQAANPVIRGTVNMPSASSTVPEYTTTPPETAYYGQ
PNLSGAANVRLSTCAASANDPVCQAQDGALTSANTPRPAVSVYDPAVTAARDITRNPSSALGSLADYYSG
CTTAEVSTAAGTTTKVCNRYSGVGNYTTRRDLTVEIDLQPSCIEGTWIAHGQVNRNGADYMVAEAQCQLR
SDGLQRFRFYAAGGKGACIGWQTVDLPTAPATQTTYVTNLAPHWEGHCWSPFAVTMMPGSGCTGGACNYT
FQFGSSWSLPLSFIQPAMVQHETDVWVDKSAVLNAGGRCAITTADTCVDGPATKAIEGRAVTRACWSYER
TMTCTSGAPIDECAALASSGCTPASSNCKQMNVGSGLCEITQDTFTCPVAAQTATTASNCPANVYCLGAN
CFNTSYTNDADFARSMSMMEAGREAGVYLDTTKMQVFKGEGNRCRHRLLKNCCSSDSAGAGMTNQSLFGT
GSSLVYDVLMNSQNREFLYQGMQALLLGGGFSGSFTTYGITVAVNGTALPASSAVLYSGESLVVAFDPWS
LVIAIVIYIIMSMSSCNEEEGKLAMKEGAGLCHTVGTWCSSCFRLFGKCVSCLEHSTGKCCFNSKLARIV
NEQGRVQVGKGWGSGESPDCSGFTIAQLQSLDFAAMDLTEFYASIVPTLPNTGALQGSNAARLTTCYYGQ
GKCQ
 
Nucleotide Sequence: 2115 bp     [Download]
>gi|71905642|ref|NC_007298.1|:2506291-2508405 Dechloromonas aromatica RCB, complete genome
ATGATCGCCATGCGCCGCCTGATCATCTGGATCACGCTGTTCTGCTTCATCACGACGCAGAGCGCCGCCA
TCGCCGGGCCATTTGAAGAAGGCACCGCCGCCGGCCAGGCGGCCAACCCGGTCATCCGCGGCACAGTTAA
CATGCCCAGCGCCTCGAGCACCGTGCCGGAGTACACCACGACGCCCCCCGAAACGGCGTATTACGGCCAG
CCCAACCTGTCGGGTGCAGCCAATGTCCGCCTGAGCACCTGCGCGGCCAGCGCCAACGATCCAGTCTGCC
AGGCCCAGGATGGCGCGCTAACCTCGGCCAACACGCCCCGCCCGGCAGTCTCCGTCTACGATCCGGCAGT
CACTGCGGCCCGCGACATCACCCGCAATCCATCGAGTGCTTTGGGCAGCCTGGCTGACTATTACTCCGGC
TGCACGACTGCCGAGGTCAGCACCGCAGCAGGCACCACGACCAAGGTCTGCAACCGCTACAGCGGTGTCG
GCAACTACACGACGCGGCGCGATCTGACGGTGGAGATAGATCTCCAGCCCAGTTGCATCGAAGGCACCTG
GATCGCCCACGGCCAGGTCAACCGCAATGGCGCCGACTATATGGTGGCGGAAGCTCAATGCCAACTGCGC
AGCGATGGGCTGCAACGTTTTCGTTTCTATGCGGCGGGCGGCAAAGGGGCCTGCATCGGCTGGCAAACCG
TCGACCTGCCGACCGCACCAGCCACCCAGACCACCTATGTCACCAACCTCGCTCCCCATTGGGAGGGCCA
TTGCTGGAGCCCGTTCGCGGTCACCATGATGCCGGGTTCCGGCTGCACGGGCGGGGCGTGCAATTACACC
TTCCAGTTTGGTTCAAGCTGGAGCCTACCCTTGTCATTCATCCAGCCGGCCATGGTGCAACACGAGACCG
ATGTCTGGGTCGACAAGAGTGCCGTGCTCAATGCGGGTGGGCGCTGCGCTATCACTACTGCCGACACCTG
CGTCGACGGCCCGGCGACGAAGGCCATCGAAGGCCGCGCCGTGACCCGTGCCTGCTGGTCCTATGAGCGC
ACAATGACCTGCACCTCGGGCGCCCCGATCGACGAGTGTGCAGCGCTGGCCAGCAGCGGCTGCACCCCGG
CCAGCAGCAACTGCAAGCAGATGAATGTCGGCAGCGGGCTGTGCGAGATCACCCAGGACACCTTTACCTG
CCCGGTCGCCGCGCAAACCGCAACCACCGCCTCGAACTGCCCGGCCAACGTCTACTGCCTGGGTGCGAAC
TGCTTCAATACCAGTTACACCAACGATGCCGACTTTGCCCGCTCGATGTCCATGATGGAAGCCGGACGTG
AGGCCGGCGTTTACCTCGACACCACCAAAATGCAGGTCTTCAAGGGCGAAGGCAACCGCTGCCGCCACCG
CCTGCTGAAGAACTGTTGCAGTTCAGATTCGGCTGGCGCCGGCATGACCAATCAGAGCCTGTTCGGCACC
GGCTCAAGTCTGGTCTACGACGTGCTGATGAATTCCCAGAACCGCGAGTTCCTTTATCAGGGCATGCAGG
CCTTGCTGCTAGGCGGCGGTTTCAGCGGTAGCTTCACCACCTATGGCATCACCGTCGCGGTCAACGGCAC
GGCACTGCCGGCCAGTTCGGCCGTACTCTATTCCGGTGAAAGCCTGGTCGTCGCCTTCGACCCCTGGTCC
CTAGTCATCGCGATCGTCATCTACATCATCATGTCGATGTCTTCCTGCAACGAGGAAGAAGGCAAGCTCG
CCATGAAGGAAGGGGCCGGCCTGTGCCATACCGTCGGCACCTGGTGCTCATCCTGCTTCCGCCTCTTCGG
CAAGTGCGTCTCCTGCCTCGAACACAGCACCGGCAAGTGTTGCTTCAACAGCAAACTCGCCCGCATCGTC
AATGAACAGGGCCGCGTGCAGGTCGGCAAGGGCTGGGGCTCGGGCGAAAGCCCCGACTGCTCGGGGTTCA
CCATCGCGCAACTCCAGAGCCTCGACTTTGCGGCCATGGACCTCACGGAGTTCTACGCCTCCATCGTCCC
GACGCTGCCCAATACCGGCGCGCTGCAGGGCAGCAATGCCGCGCGCCTGACGACTTGCTACTACGGACAA
GGGAAGTGCCAATGA
 Primer design