SecReT4
Protein ID: 71907948
T4SS name [ID]Tra_F [598]
Gene symbol-
Locus tagDaro_2329
StrainDechloromonas aromatica RCB
Repliconchromosome [GenBank: NC_007298] [Browse all T4SS(s) in this replicon]
Location [Strand]2508785..2509648 [+]
Producthypothetical protein
Component typeTraF_F
UniProt IDQ47DL6
KEGG IDdar:Daro_2329
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 1.8e-67, Aligned region: 40..261
Thioredoxin_8 [PF13905], Evalue: 2.5e-06, Aligned region: 168..207
Thioredoxin_2 [PF13098], Evalue: 1.3e-05, Aligned region: 167..259
AhpC-TSA [PF00578], Evalue: 4.8e-05, Aligned region: 160..207
Protein Sequence: 287 a.a.     [Download]
>gi|71907948|ref|YP_285535.1| hypothetical protein Daro_2329 [Dechloromonas aromatica RCB]
MTIRNRPALPLLLTFVVMFGSDSATAQDATSRYWADSWRGWHFYEMPAPEEHELPLPPGKTSATAPPTLP
PRAPELVEFERLQKTLEETRNIAIMRPSEANVRRYMELESQVVARASYFADVAQRVAWATPQLDPTLQGR
PVNAKALEVFDQAELVDRSRAIADLGKDHVLFFFYRSDCPYCHAFAPTLAAFQARHGIQVVAISVDGGPL
PSFPNARPDNGIATTLKVSQVPAVFLAQPFTGKISPIGFGVLSESQLLERIATVSAPQAEALLPTTTQGL
ALPPEVP
 
Nucleotide Sequence: 864 bp     [Download]
>gi|71905642|ref|NC_007298.1|:2508785-2509648 Dechloromonas aromatica RCB, complete genome
ATGACGATCCGTAACCGCCCCGCCCTCCCGCTGCTGCTGACCTTTGTTGTGATGTTCGGTAGCGATAGCG
CAACAGCCCAGGATGCGACTTCCCGCTACTGGGCCGACAGTTGGCGCGGCTGGCATTTCTATGAAATGCC
AGCACCCGAGGAACACGAACTTCCATTGCCACCGGGCAAGACCTCAGCAACTGCGCCACCGACTCTACCG
CCGCGCGCACCGGAACTGGTCGAATTCGAACGCCTCCAGAAAACCCTTGAAGAGACGCGCAATATCGCCA
TCATGCGACCGAGCGAAGCCAATGTCCGGCGCTACATGGAACTGGAGTCCCAGGTCGTCGCCCGCGCTTC
CTATTTCGCCGACGTCGCGCAGCGCGTGGCCTGGGCTACACCGCAACTGGACCCAACCCTGCAGGGCCGC
CCAGTCAATGCCAAGGCCCTGGAAGTCTTCGACCAGGCCGAACTGGTCGATCGTTCGCGCGCCATTGCCG
ACCTGGGCAAGGATCACGTGTTGTTCTTCTTTTATCGCTCGGATTGTCCGTACTGCCATGCCTTCGCACC
GACCTTGGCAGCCTTCCAGGCCCGTCACGGCATCCAAGTCGTCGCCATCAGCGTGGACGGTGGTCCGCTG
CCGAGTTTCCCCAATGCCCGCCCGGACAACGGCATTGCCACCACCCTGAAGGTCAGCCAGGTACCCGCCG
TTTTTCTGGCTCAACCCTTCACCGGAAAGATATCCCCCATCGGCTTCGGTGTGCTCTCGGAATCCCAGTT
ACTCGAACGCATTGCCACGGTGTCCGCTCCGCAAGCCGAGGCCCTGCTGCCTACAACCACGCAAGGTCTC
GCCCTACCCCCGGAGGTGCCATGA
 Primer design