SecReT4
Protein ID: 71907949
T4SS name [ID]Tra_F [598]
Gene symbol-
Locus tagDaro_2330
StrainDechloromonas aromatica RCB
Repliconchromosome [GenBank: NC_007298] [Browse all T4SS(s) in this replicon]
Location [Strand]2509645..2511093 [+]
Producthypothetical protein
Component typeTraH_F
UniProt IDQ47DL5
KEGG IDdar:Daro_2330
PDB IDNA
Domain hit(s) vs Pfam TraH [PF06122], Evalue: 1.9e-97, Aligned region: 37..396
Protein Sequence: 482 a.a.     [Download]
>gi|71907949|ref|YP_285536.1| hypothetical protein Daro_2330 [Dechloromonas aromatica RCB]
MKHYDHPHLRRSAAAFLALLLAIPSFQLQAGDLNSEVNNMFNNLGSIGNYTAPGAFRGQTFNTYTGGNLM
MRSPNKVYQLAAIQFPSAKAGCGGIDVFGGSFSHISATEFKNMLKNITAALPGIAFQLALEAVSPLLGGL
TKWAKGLETWINNARINSCETAKAIVSTAAESIGYSSQETCADLAIEMGMESDRDAARRRCATDRPSILS
SARSSADPKVKNKAPFVGNLTWKALQYTGAYLDDQERELIMSLVGTIIYYPEESARDPEPIAPTLTSISQ
LLYGQGAAAGTDVVQHVLKCNDYSNCDVVTLNTTYTHTPFTAKVEAIMRSIAEKITTRTAIPNNSTEVGF
VNQTTEPVYKMLSIGTSIPGSGLADSLIAQYRDVIAADYAYVFLERNLRLGMAALDKNYTLQQSQREQAN
QVRQRAQAMLTQLSQEKNLLYQKVGSFRAVSNHLEQLERQLRSSMPQHVMDMLGQQAAYLSQ
 
Nucleotide Sequence: 1449 bp     [Download]
>gi|71905642|ref|NC_007298.1|:2509645-2511093 Dechloromonas aromatica RCB, complete genome
ATGAAACATTACGACCATCCTCATTTGCGGCGCAGCGCTGCCGCCTTCCTGGCGCTGCTGCTGGCGATCC
CGTCCTTCCAACTGCAGGCGGGCGACCTCAATAGCGAGGTGAACAACATGTTCAACAATCTAGGCTCCAT
TGGCAACTACACCGCCCCCGGTGCCTTCCGTGGCCAGACCTTCAATACCTACACCGGCGGCAACTTGATG
ATGCGCTCGCCGAACAAGGTTTATCAGTTGGCTGCCATCCAATTCCCCAGCGCCAAAGCCGGCTGCGGCG
GCATCGACGTCTTTGGCGGCTCCTTCTCGCACATTTCGGCAACCGAGTTCAAGAACATGCTGAAGAACAT
CACGGCTGCCCTGCCGGGAATCGCTTTCCAACTCGCACTGGAAGCGGTCTCGCCGCTGCTCGGCGGACTG
ACCAAATGGGCCAAGGGACTGGAGACCTGGATCAACAATGCCCGGATCAATTCCTGCGAGACCGCCAAGG
CCATAGTCAGCACGGCAGCCGAATCGATTGGCTACAGTTCGCAGGAAACCTGTGCCGATCTGGCCATCGA
GATGGGCATGGAAAGCGATCGTGATGCAGCGCGTCGGCGCTGTGCGACGGATCGGCCGAGCATTCTGTCG
TCAGCACGCTCCTCGGCCGACCCGAAGGTGAAAAACAAGGCGCCCTTCGTCGGCAACCTAACCTGGAAAG
CCTTGCAGTACACCGGTGCCTATCTCGACGATCAGGAGCGCGAACTGATCATGAGCCTGGTTGGCACCAT
TATCTATTACCCGGAAGAGTCGGCCCGCGACCCCGAGCCGATCGCCCCGACGCTGACCTCGATCAGCCAG
TTGCTCTACGGACAGGGTGCGGCCGCCGGTACGGATGTCGTGCAGCATGTCTTGAAGTGCAACGACTACA
GCAATTGCGACGTCGTCACCTTGAACACCACGTACACCCACACGCCCTTTACCGCCAAGGTCGAGGCGAT
CATGCGCTCCATTGCCGAAAAGATCACCACGCGCACCGCCATCCCCAATAACTCGACCGAGGTCGGCTTC
GTGAATCAGACCACCGAGCCGGTTTACAAGATGTTGTCCATCGGCACCAGCATTCCGGGATCGGGCTTGG
CCGACAGCCTGATCGCCCAGTACCGCGATGTGATTGCCGCCGACTACGCCTATGTTTTCCTTGAACGCAA
TCTGCGGCTCGGCATGGCCGCGCTGGACAAGAACTACACCCTGCAGCAGTCGCAACGCGAGCAGGCCAAC
CAGGTCCGTCAGCGGGCACAAGCCATGCTCACGCAACTCTCCCAGGAAAAGAACCTGCTCTACCAGAAGG
TCGGCTCCTTCCGGGCAGTATCGAACCACCTGGAGCAACTCGAACGCCAACTACGTTCCAGCATGCCGCA
ACACGTGATGGACATGCTCGGCCAGCAGGCCGCCTATCTGTCGCAATAG
 Primer design