SecReT4
Protein ID: 71907950
T4SS name [ID]Tra_F [598]
Gene symbol-
Locus tagDaro_2331
StrainDechloromonas aromatica RCB
Repliconchromosome [GenBank: NC_007298] [Browse all T4SS(s) in this replicon]
Location [Strand]2511127..2513898 [+]
Producthypothetical protein
Component typeTraG_F
UniProt IDQ47DL4
KEGG IDdar:Daro_2331
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 3e-110, Aligned region: 3..469
Protein Sequence: 923 a.a.     [Download]
>gi|71907950|ref|YP_285537.1| hypothetical protein Daro_2331 [Dechloromonas aromatica RCB]
MWEIYAYQNADSLFGVFNAAAAIHASGDYAAALAAVAFCGFVAALIAYAFAPEKLQGWKWLGTVVLVFSV
LIVPKVTVGIVDKTGGSAIKVVGNVPFGVAALGSITSTIGNTLTSLFETAFQVIPGAGALPVELSYQQNG
LMFGNRLIRETGNVVFQDPAFRTDLINFIHNCTTYDLIDGTLDPAVFSASDDVWPLMASPNPARFSTLTG
AGGSVGVDTCPNVYLSLNGRLPAQITRIQGRLAFQLNPTLPGAAAAAAIAGQIQQAYIKNSIATAAATAA
DIIRQNAMLNALEDTSKIVGQKVNDPAAMVLAVGRAQAVAQQNASWLNYGKVAEQALPVFRNVVEAVTYA
MFPLFVMLLLLTSGRETMLAFKGYAAVLIWIQLWPPLYAILNYMASIYAAYDLAAAADLGTGGKSLALQT
ASTIYSRAISGEAVVGYLAISIPFIAWAALKRMENFGTALVGGLSGLQGMISGGTSAATVGNVSMGNVGM
DQMQLAPNRTSAFMGSWQNDISGNTFSSNALTGRTAVSLLRNQGFASRMVSMRVSEQDVAQASKQVDAAQ
NEAVAASTERSAILSEAFSRGLSKLRSSRSSSGSTSSSFEQTGETLNRLDQISKSVAENTGMSQSQVASI
AFGATGHLGFNAGAVGGRLSASANKSYLSGLSTQEQKVLGSMSSEQLAEFKQFGDRVSRDAGFMSAISND
SREANDMTSRLASTHARSERAEANLAERIAFAERVSTAHEKGESISIDIAQDPHNLEMFMRYAEQYGGNS
AAAHALMESELARQSLRPNRVFSDGTALPASFGDIREQHAQQRSDAELTPDIDGLHQSNRQQTSRIATDS
PTQRAATTVSPIRDDVRTSGNQIRTDAASSRAEFDAKAEIVKTDDGTLASKKSLLVQSGKQVGKDAGATL
ENTKDMVKDLLRK
 
Nucleotide Sequence: 2772 bp     [Download]
>gi|71905642|ref|NC_007298.1|:2511127-2513898 Dechloromonas aromatica RCB, complete genome
ATGTGGGAAATCTACGCCTACCAGAATGCCGACAGCCTGTTCGGCGTCTTCAATGCAGCGGCAGCGATTC
ACGCCTCGGGCGACTACGCCGCTGCCCTGGCTGCCGTGGCATTTTGCGGTTTTGTGGCCGCCTTGATTGC
CTACGCTTTCGCTCCCGAGAAGTTGCAGGGTTGGAAGTGGCTGGGCACAGTCGTGTTGGTCTTTTCGGTG
TTGATCGTGCCCAAGGTCACGGTGGGCATCGTGGACAAGACCGGCGGTTCGGCCATCAAAGTCGTCGGCA
ACGTGCCGTTCGGGGTGGCCGCACTCGGCAGCATCACCAGCACGATCGGCAACACGCTGACCAGTCTGTT
CGAAACGGCATTCCAGGTCATTCCAGGTGCCGGAGCGCTCCCGGTTGAATTGAGCTACCAGCAGAACGGC
CTGATGTTCGGCAACCGACTGATCCGCGAGACTGGCAATGTGGTGTTTCAGGATCCAGCTTTCCGCACCG
ACCTGATCAACTTCATCCACAACTGCACGACCTACGATCTGATCGATGGCACGCTCGATCCGGCGGTCTT
TTCTGCATCGGATGATGTCTGGCCGCTGATGGCCTCACCCAATCCGGCGCGCTTCAGTACGCTGACCGGT
GCTGGCGGCAGTGTCGGCGTCGATACCTGCCCCAATGTCTATCTGAGCCTCAATGGCCGCTTGCCGGCCC
AGATCACCCGCATCCAGGGGCGCCTGGCCTTTCAGCTCAATCCGACCTTGCCCGGCGCCGCTGCTGCAGC
GGCCATTGCCGGACAGATTCAGCAGGCCTATATCAAGAACAGCATCGCCACCGCAGCGGCGACGGCGGCC
GACATCATTCGGCAGAACGCTATGCTCAACGCGCTTGAGGACACCAGCAAGATCGTCGGCCAAAAGGTCA
ATGATCCGGCGGCTATGGTTCTGGCGGTCGGCCGCGCCCAGGCGGTGGCACAACAGAACGCCTCCTGGCT
CAATTACGGCAAGGTGGCCGAGCAAGCGCTGCCCGTGTTCCGCAACGTGGTCGAGGCGGTGACCTACGCG
ATGTTTCCACTCTTCGTGATGCTCCTGCTGCTGACCAGCGGACGGGAGACAATGCTCGCCTTCAAAGGCT
ATGCGGCCGTGCTGATCTGGATTCAGTTGTGGCCGCCGCTCTACGCCATCCTGAACTACATGGCTTCGAT
CTACGCGGCTTACGACCTCGCCGCCGCTGCCGACCTCGGAACGGGGGGCAAATCGCTGGCATTGCAGACG
GCTTCGACGATCTATTCGCGGGCAATCTCGGGGGAAGCCGTTGTCGGTTACCTCGCCATCAGTATTCCAT
TCATTGCGTGGGCCGCCCTGAAGCGCATGGAAAACTTTGGAACAGCGTTGGTCGGTGGCTTGTCGGGGTT
GCAAGGAATGATCTCGGGCGGAACCTCGGCCGCCACCGTTGGTAACGTCTCAATGGGGAACGTCGGTATG
GACCAGATGCAACTGGCGCCCAACCGTACGTCGGCATTCATGGGCAGTTGGCAAAACGACATCTCCGGAA
ATACGTTCTCGTCGAACGCGCTGACCGGTCGTACTGCCGTCTCGTTGCTTCGCAACCAGGGATTTGCTTC
CCGGATGGTTTCGATGCGGGTGTCTGAGCAGGATGTGGCCCAGGCCAGCAAGCAGGTTGATGCAGCACAA
AACGAAGCCGTCGCAGCTAGCACCGAACGCTCAGCAATCTTGTCAGAGGCGTTCTCTCGAGGATTGAGCA
AATTGCGTTCATCGCGCAGTAGCAGTGGCTCCACGTCCAGTAGCTTCGAACAAACGGGTGAAACGTTGAA
CAGACTGGATCAGATATCAAAGAGCGTGGCCGAAAATACTGGAATGTCGCAGTCTCAAGTTGCCAGTATC
GCGTTCGGAGCAACGGGGCATCTAGGATTTAACGCCGGCGCAGTTGGGGGGCGCCTAAGCGCTAGCGCAA
ATAAGAGTTACCTATCTGGCTTATCAACCCAGGAACAAAAGGTCTTGGGCAGCATGAGCAGCGAACAGTT
AGCAGAGTTCAAACAGTTCGGTGACAGGGTGTCACGCGATGCTGGTTTCATGAGCGCGATATCAAATGAC
TCCCGCGAAGCAAACGACATGACTTCCCGGCTCGCCTCCACGCATGCGCGTTCGGAACGCGCCGAAGCAA
ACCTCGCCGAACGCATAGCTTTCGCGGAGCGTGTCTCTACAGCTCACGAAAAGGGAGAAAGCATTTCCAT
CGATATCGCTCAGGATCCGCACAATTTGGAAATGTTTATGCGCTACGCTGAGCAGTATGGTGGCAACAGT
GCCGCAGCGCATGCATTGATGGAATCTGAATTGGCGCGGCAGTCGCTTCGGCCGAACCGGGTGTTTTCCG
ACGGAACTGCCCTGCCCGCATCCTTTGGAGACATCAGAGAGCAACATGCACAACAGCGAAGCGATGCTGA
GCTGACGCCCGACATTGATGGTCTACATCAATCCAACCGACAACAAACCTCGCGGATTGCGACTGACTCA
CCGACCCAGCGAGCGGCAACCACCGTATCGCCGATTCGAGATGATGTTCGCACTAGTGGCAATCAAATTC
GCACGGATGCGGCATCAAGCCGTGCAGAATTTGACGCCAAGGCTGAGATCGTCAAAACCGATGACGGAAC
GCTTGCGTCCAAAAAGTCGCTATTAGTTCAGTCGGGCAAACAGGTAGGGAAGGACGCCGGAGCGACGCTC
GAGAATACAAAGGATATGGTGAAGGACTTACTGCGGAAATAG
 Primer design