SecReT4
Protein ID: 71908257
T4SS name [ID]Tra_F [599]
Gene symbol-
Locus tagDaro_2644
StrainDechloromonas aromatica RCB
Repliconchromosome [GenBank: NC_007298] [Browse all T4SS(s) in this replicon]
Location [Strand]2841019..2841567 [+]
Productlytic transglycosylase, catalytic
Component typeOrf169_F
UniProt IDQ47CQ7
KEGG IDdar:Daro_2644
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 182 a.a.     [Download]
>gi|71908257|ref|YP_285844.1| lytic transglycosylase, catalytic [Dechloromonas aromatica RCB]
MRLLAVAPFAALAILATKPTWALACWEEAAQRYGISAELLYAIARVESNLNPNAVNRTHIQRTGSYDIGL
MQINSGHLSTLSRHGIKEADLFVPCTNIQVGAWLLSDLFSRQGATWDTVGAYNAACSQLKGEACSKARAQ
YAWRVYRQLPAQHGSQLSGEIKRGKQTPRGETFALMSVRVAP
 
Nucleotide Sequence: 549 bp     [Download]
>gi|71905642|ref|NC_007298.1|:2841019-2841567 Dechloromonas aromatica RCB, complete genome
ATGCGTCTGCTGGCTGTTGCCCCATTTGCTGCCCTTGCCATTCTGGCAACCAAGCCCACCTGGGCCCTAG
CCTGCTGGGAAGAAGCAGCTCAACGCTACGGCATATCAGCCGAGTTGCTCTACGCCATCGCCCGTGTCGA
ATCGAACCTGAATCCGAACGCGGTCAACCGCACGCATATACAGCGCACCGGCTCCTACGATATCGGACTC
ATGCAGATCAACAGTGGCCATCTTTCAACCCTGTCACGCCACGGCATCAAGGAAGCAGATCTCTTCGTAC
CATGCACCAACATTCAGGTCGGTGCCTGGTTGTTGTCCGACCTGTTCTCCCGGCAGGGCGCGACCTGGGA
TACGGTCGGTGCCTACAATGCCGCCTGCTCACAACTCAAGGGTGAAGCCTGCTCCAAAGCCCGCGCCCAA
TACGCCTGGCGGGTGTATCGCCAGTTGCCCGCGCAACATGGCAGCCAACTCTCCGGGGAAATAAAGAGGG
GCAAACAGACGCCCCGAGGCGAAACATTCGCCCTGATGTCGGTAAGGGTGGCGCCATGA
 Primer design