SecReT4
Protein ID: 71908261
T4SS name [ID]Tra_F [599]
Gene symbol-
Locus tagDaro_2648
StrainDechloromonas aromatica RCB
Repliconchromosome [GenBank: NC_007298] [Browse all T4SS(s) in this replicon]
Location [Strand]2843072..2843638 [+]
Productplasmid-like conjugative transfer protein TraE
Component typeTraE_F
UniProt IDQ47CQ3
KEGG IDdar:Daro_2648
PDB IDNA
Domain hit(s) vs Pfam TraE [PF05309], Evalue: 2.8e-34, Aligned region: 1..185
Protein Sequence: 188 a.a.     [Download]
>gi|71908261|ref|YP_285848.1| plasmid-like conjugative transfer protein TraE [Dechloromonas aromatica RCB]
MDFERLNGDIKEMRRRNRGLSLTVGVLAAGQILALIVILNLLGTVRTIVVPPSIDKTFWVTRDKASSEYL
EQMGSFIAWLVLDVTPASIDWKKDILLGYVEPEQYGPLKTRQEVEAERLKRINAATVFAPQQLVPSEEGQ
SVVIRGRLRTLVNGFETANDLKAYRVEFSYAGARMHLKSFKEVANVGN
 
Nucleotide Sequence: 567 bp     [Download]
>gi|71905642|ref|NC_007298.1|:2843072-2843638 Dechloromonas aromatica RCB, complete genome
ATGGACTTCGAACGACTCAACGGCGACATCAAGGAAATGCGCCGCCGCAACCGGGGGCTGAGTCTCACCG
TCGGCGTCCTGGCGGCCGGCCAGATTCTCGCCCTGATCGTCATCCTCAACCTGCTCGGTACGGTACGCAC
CATCGTCGTGCCGCCCTCAATCGACAAGACCTTCTGGGTCACCCGTGACAAGGCCAGCAGCGAGTACCTG
GAGCAGATGGGCAGTTTCATTGCCTGGCTGGTCCTCGACGTGACGCCGGCCTCAATCGACTGGAAGAAGG
ACATCCTGCTTGGCTACGTCGAACCGGAACAGTACGGCCCGCTGAAGACCCGGCAGGAAGTGGAAGCCGA
ACGCCTGAAACGCATCAATGCCGCCACCGTGTTCGCACCCCAGCAACTGGTTCCCAGCGAAGAAGGCCAG
AGCGTCGTCATTCGCGGACGGCTACGCACCCTGGTCAATGGCTTCGAGACAGCCAACGACCTCAAGGCCT
ATCGCGTCGAGTTCAGCTACGCCGGCGCGCGCATGCATCTGAAAAGTTTCAAGGAGGTAGCCAATGTCGG
CAACTGA
 Primer design