SecReT4
Protein ID: 71908262
T4SS name [ID]Tra_F [599]
Gene symbol-
Locus tagDaro_2649
StrainDechloromonas aromatica RCB
Repliconchromosome [GenBank: NC_007298] [Browse all T4SS(s) in this replicon]
Location [Strand]2843625..2844506 [+]
Producthypothetical protein
Component typeTraK_F
UniProt IDQ47CQ2
KEGG IDdar:Daro_2649
PDB IDNA
Domain hit(s) vs Pfam TraK [PF06586], Evalue: 7.8e-26, Aligned region: 25..286
Protein Sequence: 293 a.a.     [Download]
>gi|71908262|ref|YP_285849.1| hypothetical protein Daro_2649 [Dechloromonas aromatica RCB]
MSATDTQQPLSRPVPMPTPRRRWAMSSTLAVAGIAAITALPAQALQLVEASDGAAVEAILSIREPTRIRI
EGASITDVFGNIHSSQCGMAAALPATPGMAPAGAGSSPINPAGEIALTCDRDKGEIYVRPVGDSAKPINL
FVASANATYTLLLRRSDTPADTIVIRDRTPKALKHASSAQIPAGQSPNQVRAMKALLVAMTSDRVPPDIR
VEETRGTLPLWNEARFSRVRQYEGRGLVGEKYLLQNISDAPMVLAEPEFDREQGSVVGIAIEHHNLRPGE
STSVYVIRRGETP
 
Nucleotide Sequence: 882 bp     [Download]
>gi|71905642|ref|NC_007298.1|:2843625-2844506 Dechloromonas aromatica RCB, complete genome
ATGTCGGCAACTGATACCCAACAGCCCCTATCCCGACCGGTTCCAATGCCAACGCCTCGGCGCAGATGGG
CAATGAGCTCTACGTTAGCCGTCGCCGGTATCGCCGCCATCACGGCGCTGCCCGCCCAGGCACTGCAACT
CGTCGAGGCCAGCGACGGCGCGGCAGTCGAAGCCATCCTGTCGATCCGGGAACCGACCCGCATCCGCATC
GAAGGGGCGTCGATCACCGACGTCTTCGGCAATATCCATTCGAGCCAATGCGGCATGGCGGCAGCCCTTC
CCGCCACCCCGGGCATGGCGCCCGCCGGTGCCGGTTCATCGCCGATCAATCCGGCCGGCGAGATCGCGCT
GACCTGTGATCGCGACAAGGGCGAAATCTATGTCCGTCCTGTCGGTGATTCGGCCAAACCGATCAATCTC
TTCGTCGCATCGGCCAACGCCACCTACACGCTGCTGCTGCGCCGTTCGGATACCCCGGCCGATACGATCG
TCATCCGTGACAGGACGCCGAAGGCATTGAAGCATGCGTCATCGGCTCAGATTCCGGCCGGCCAGTCTCC
CAACCAGGTACGGGCGATGAAGGCGCTCCTGGTAGCCATGACTTCAGATCGGGTACCACCGGATATCCGG
GTCGAAGAGACCCGCGGCACGCTCCCGTTATGGAACGAGGCGCGGTTTTCGCGGGTGCGCCAGTACGAGG
GGCGCGGCCTGGTCGGCGAGAAATACCTGCTGCAGAACATCAGCGATGCCCCCATGGTCTTGGCCGAACC
GGAGTTCGACCGTGAACAGGGCAGCGTCGTCGGCATTGCCATCGAGCACCACAACCTTCGCCCCGGCGAA
AGCACCAGCGTCTATGTAATCCGCCGCGGAGAGACGCCATGA
 Primer design