SecReT4
Protein ID: 71908263
T4SS name [ID]Tra_F [599]
Gene symbol-
Locus tagDaro_2650
StrainDechloromonas aromatica RCB
Repliconchromosome [GenBank: NC_007298] [Browse all T4SS(s) in this replicon]
Location [Strand]2844503..2845876 [+]
ProductTraB pilus assembly
Component typeTraB_F
UniProt IDQ47CQ1
KEGG IDdar:Daro_2650
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 1.6e-45, Aligned region: 231..425
Protein Sequence: 457 a.a.     [Download]
>gi|71908263|ref|YP_285850.1| TraB pilus assembly [Dechloromonas aromatica RCB]
MTTPRQWMHTLRGLPQQLLQHLSPRQRQYAMLGALLAGGVGLLWSIFAFTASSPPTSSTQPAAGPASSVT
NIGVMSPGAQVNPVDQWVGTAGRKLAQYENEREEQGRLNKDRQTFEAKTMQRFAELEQRLTSTQQAASTP
PPPTPVPTMPPAASLPPAPPPSKGLSAGAMPSGMPGELLPPSPLIAPTPAITRISVAERSLLASTGEKAE
RAAGAGSQASTRTVATFLPVSFTRGTLLGGLDAPTGGQSQSNPHPVLIRLSDNSFLPNRFRAEYRECFVV
AAGYGDISSERAYLRTESLSCVRTDGATLEVKIQGSIYGEDGKVGMRGRLVTKQGQMLANALLAGVVSGI
GQGLATSSTEYSTSALGTVASATGSEAYRAGLGSGVGKALDRLAQYYIKLAENTFPVIEVDAGREVDVVI
TKGVRIDVPMTSGEPSSARFANSPETRYLETSDDGNY
 
Nucleotide Sequence: 1374 bp     [Download]
>gi|71905642|ref|NC_007298.1|:2844503-2845876 Dechloromonas aromatica RCB, complete genome
ATGACGACGCCACGTCAGTGGATGCACACGCTGCGGGGCTTACCGCAGCAATTGCTACAGCACCTCTCCC
CGCGGCAACGCCAGTACGCCATGCTCGGCGCGTTGCTGGCCGGCGGCGTCGGGCTGCTCTGGTCGATTTT
CGCATTCACGGCAAGCAGTCCGCCGACGAGCAGCACGCAACCCGCCGCCGGGCCGGCCAGTTCGGTCACC
AACATTGGCGTGATGTCACCCGGCGCTCAGGTCAATCCGGTCGACCAATGGGTCGGCACGGCCGGGCGCA
AGCTTGCCCAGTACGAGAACGAACGCGAAGAACAGGGACGACTCAACAAGGATCGCCAGACCTTCGAAGC
GAAAACGATGCAGCGCTTTGCCGAACTGGAACAGCGACTGACTTCGACCCAGCAGGCGGCCTCTACGCCC
CCGCCACCCACGCCAGTCCCGACCATGCCGCCGGCGGCGAGCCTGCCCCCTGCTCCACCGCCTTCCAAGG
GCTTGTCCGCCGGAGCAATGCCAAGCGGCATGCCCGGCGAACTGCTGCCTCCGAGCCCCCTTATTGCACC
AACGCCAGCGATTACCCGGATTAGCGTTGCCGAGCGCTCCCTGCTCGCCAGCACGGGAGAGAAAGCAGAG
CGCGCCGCAGGGGCCGGATCGCAAGCATCCACCCGGACCGTCGCCACCTTCCTGCCCGTCAGTTTCACCC
GTGGCACGCTGCTGGGTGGCCTGGATGCGCCGACCGGCGGTCAATCGCAATCCAATCCGCACCCAGTCCT
GATCCGTCTTTCAGACAACTCGTTCCTGCCCAACCGCTTCCGCGCCGAATACCGGGAGTGCTTTGTGGTG
GCCGCCGGCTATGGCGACATCAGTTCCGAGCGTGCTTACCTGCGCACCGAGAGTCTGTCTTGCGTACGAA
CCGACGGCGCGACGCTGGAAGTCAAGATTCAGGGCTCGATCTACGGCGAGGATGGCAAGGTCGGCATGCG
CGGGCGGCTGGTCACCAAGCAGGGCCAGATGCTCGCCAACGCCCTGCTGGCCGGCGTGGTCAGCGGTATC
GGCCAAGGCCTGGCGACCTCGTCGACCGAGTACAGCACCTCGGCCCTCGGCACAGTCGCCAGCGCCACCG
GTTCCGAAGCCTATCGCGCCGGCCTCGGCTCCGGTGTCGGCAAGGCCCTCGACCGGCTGGCCCAGTACTA
CATCAAGCTCGCCGAGAACACCTTCCCGGTCATCGAAGTGGACGCCGGCCGCGAGGTCGACGTTGTGATC
ACCAAGGGCGTGCGCATCGATGTGCCGATGACAAGCGGCGAACCGTCTTCCGCCCGCTTCGCCAATTCCC
CTGAAACTCGTTACCTGGAGACCTCGGACGATGGCAACTACTAA
 Primer design