SecReT4
Protein ID: 71908265
T4SS name [ID]Tra_F [599]
Gene symbol-
Locus tagDaro_2652
StrainDechloromonas aromatica RCB
Repliconchromosome [GenBank: NC_007298] [Browse all T4SS(s) in this replicon]
Location [Strand]2846678..2847259 [+]
Producthypothetical protein
Component typeTraV_F
UniProt IDQ47CP9
KEGG IDdar:Daro_2652
PDB IDNA
Domain hit(s) vs Pfam TraV [PF09676], Evalue: 2.7e-28, Aligned region: 30..138
Protein Sequence: 193 a.a.     [Download]
>gi|71908265|ref|YP_285852.1| hypothetical protein Daro_2652 [Dechloromonas aromatica RCB]
MKTLILQLGAACLLLPLGACMNMSGLGGDSKYACKAPDGVACDSVSGTYANALHNNLPSQQAQRSARRQK
ETSEENASPTAGRPISLATANLSGMAITPSPLRTQARILRLWIKPWEDADGDLYDQGYVYVQVDNGQWQI
DHVQHQIRDRYAPLKLPPKPAAETTTELGASTSSPLPMLQRPPLSGAGANPAQ
 
Nucleotide Sequence: 582 bp     [Download]
>gi|71905642|ref|NC_007298.1|:2846678-2847259 Dechloromonas aromatica RCB, complete genome
ATGAAGACGCTGATCTTGCAACTCGGTGCCGCCTGCCTACTGCTCCCCTTGGGCGCCTGCATGAACATGT
CCGGCCTGGGCGGCGACTCGAAGTACGCCTGCAAGGCCCCCGATGGCGTTGCCTGCGACTCGGTGTCCGG
CACCTACGCCAACGCCCTTCACAACAATCTACCCAGCCAGCAGGCCCAACGCTCCGCTCGCCGGCAGAAA
GAGACATCTGAAGAGAACGCCTCCCCCACGGCTGGACGTCCTATTTCCTTGGCAACAGCCAACCTTTCCG
GGATGGCCATAACGCCCAGTCCCTTGCGCACCCAGGCCCGCATCCTGCGGCTGTGGATCAAACCCTGGGA
AGACGCAGACGGCGATCTCTACGATCAGGGCTACGTCTATGTCCAGGTGGACAACGGCCAGTGGCAGATC
GACCACGTGCAACACCAGATCCGTGATCGCTATGCACCGCTGAAGCTGCCACCCAAGCCGGCCGCTGAGA
CGACCACCGAACTCGGCGCCAGTACGTCGTCGCCCCTACCGATGTTGCAACGCCCACCGCTGTCCGGGGC
CGGCGCCAACCCTGCGCAGTGA
 Primer design