SecReT4
Protein ID: 71908266
T4SS name [ID]Tra_F [599]
Gene symbol-
Locus tagDaro_2653
StrainDechloromonas aromatica RCB
Repliconchromosome [GenBank: NC_007298] [Browse all T4SS(s) in this replicon]
Location [Strand]2847267..2849834 [+]
Producthypothetical protein
Component typeTraC_F
UniProt IDQ47CP8
KEGG IDdar:Daro_2653
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 1.2e-68, Aligned region: 32..282
AAA_10 [PF12846], Evalue: 1.6e-46, Aligned region: 480..770
FtsK_SpoIIIE [PF01580], Evalue: 1.9e-05, Aligned region: 451..517
Protein Sequence: 855 a.a.     [Download]
>gi|71908266|ref|YP_285853.1| hypothetical protein Daro_2653 [Dechloromonas aromatica RCB]
MNTAHSDPHFARQRDHAHAPRFPFGEPADTPAEQFANWLPYSGYLAAEKIFVNRDSMGVMLELMPQSGAD
ERMAEVLISLYANCPPGTGIQFHLFASPQVRSQLRQYANLRVEDEDQAEQAKQWGRPARNGNLFRKLARQ
RVDHLLQGAQKSLTAGFHYTIRDFRLMLSVAFPGNPEDLNKRDELLALRDSMSSSLRSASLPNRVCDAAD
LINWCALFTNPDRISQTDAPDLNYDDGRELRDQIVDFDTIQDPHPSGLTLWKEASPDVLEARFYSIKSFP
ERFALWQMGSLIGDLMQPALQYSAPFLLTLGVQVLDPNLTKSVVTANHVRATQNAKSKMADVMPDVNKKL
QDWTAAADAIDTGGNLVSLYHQLAIFTAPNKSVAAHEAANAIWRGRGFQLNADAYMHRQALLASLPMTLT
EKFHKDLVKMRRVTRKTMANAIHMAPLIAEWRGTRTPALVFGGRRGQLMTLDIFDNDLGNYNFAIIGAPG
SGKSVLMNEMAWSYRAIGAKVWMLDLGRSFEKLCRKAKGTYIEFRPDVNICLDPFTHIVDINEDIDMLVP
GIAKMCSMQHTLEEVQYKAISAMVLKLWREYGNELRITGLRDAFKSGSIEELGVVGDQRIKDLAIMLNPY
SRGGQYERFFEGRNNIDFSNDFIVIENEELKRRPDLHAVVNILLLHRITGEMYLTRNRRKVLFVDELKQQ
LGDIGADDPVKAAVIEEAARRARKYGGALGTATQSADDFYGSTQMEAAFNCSDWVFLLRQKPESIEMLDR
KGRLTMDEPKKRLLNSLRTEAGVFSELYISSPVGEGVARNILDPATHLLFSNKLEDNAPIDELRAQGLSI
DEAISELLRHRGHTV
 
Nucleotide Sequence: 2568 bp     [Download]
>gi|71905642|ref|NC_007298.1|:2847267-2849834 Dechloromonas aromatica RCB, complete genome
ATGAATACCGCCCACAGCGATCCGCACTTTGCCCGCCAGCGCGACCACGCCCATGCGCCGCGCTTTCCCT
TCGGCGAACCGGCGGACACACCGGCCGAACAGTTCGCCAACTGGCTGCCCTACTCTGGCTATCTTGCCGC
CGAGAAGATTTTTGTGAACCGCGACAGCATGGGCGTCATGCTCGAGCTGATGCCGCAGTCGGGGGCCGAC
GAGCGGATGGCGGAAGTACTGATCTCGCTCTACGCCAATTGCCCACCTGGCACCGGCATCCAGTTCCATT
TGTTCGCCTCGCCGCAGGTGCGCAGCCAGTTGCGCCAGTACGCCAATCTGCGGGTCGAGGATGAGGATCA
GGCCGAGCAGGCCAAACAATGGGGCCGCCCGGCCCGCAACGGCAATCTGTTCCGCAAACTGGCTCGCCAG
CGCGTGGACCACCTGTTGCAGGGAGCACAGAAGTCGCTGACTGCCGGCTTCCACTACACGATCCGGGATT
TTCGGCTAATGCTGAGCGTTGCCTTTCCGGGCAATCCGGAAGACCTCAACAAGCGCGACGAACTGCTCGC
CCTGCGCGATTCGATGTCGTCCAGCCTGCGCTCGGCCTCGCTGCCCAATCGCGTTTGCGATGCCGCCGAT
CTGATCAACTGGTGTGCGCTATTCACCAATCCCGATCGCATCTCGCAGACCGATGCGCCGGACCTCAATT
ACGATGACGGCCGGGAACTGCGCGACCAGATCGTGGACTTCGACACCATCCAGGACCCGCATCCGAGCGG
CCTGACCTTGTGGAAGGAAGCCAGTCCCGACGTACTGGAGGCGCGCTTCTACTCGATCAAAAGTTTTCCG
GAACGCTTCGCGCTGTGGCAGATGGGGTCGCTGATCGGCGACCTGATGCAGCCGGCCTTGCAGTACAGCG
CACCGTTTCTGCTGACCCTCGGCGTCCAGGTCCTCGACCCCAACCTCACCAAGTCGGTGGTCACTGCCAA
CCATGTGCGGGCGACGCAGAATGCCAAATCGAAGATGGCCGACGTCATGCCGGACGTTAACAAGAAACTG
CAGGACTGGACGGCGGCGGCCGATGCCATCGACACCGGCGGTAATCTGGTCAGCCTCTACCACCAGTTGG
CGATATTCACCGCACCCAACAAATCGGTTGCCGCCCATGAAGCCGCCAATGCGATCTGGCGCGGCCGCGG
CTTCCAGCTCAATGCCGACGCTTACATGCACCGCCAGGCCTTGCTCGCCAGCCTGCCGATGACGCTGACC
GAGAAATTTCACAAAGACTTGGTCAAAATGCGCCGGGTCACGCGCAAGACCATGGCCAATGCCATCCACA
TGGCACCGCTGATTGCCGAGTGGCGCGGCACGCGCACGCCGGCCCTGGTGTTCGGGGGTCGCCGCGGCCA
GTTGATGACGCTCGATATCTTCGACAACGATCTCGGCAACTACAACTTTGCCATCATCGGTGCACCGGGC
TCGGGCAAGTCGGTTCTGATGAACGAAATGGCCTGGTCCTACCGCGCCATCGGCGCCAAGGTCTGGATGC
TCGATCTCGGTCGCAGTTTCGAGAAACTGTGCCGCAAGGCCAAGGGCACCTATATCGAGTTCCGGCCCGA
CGTGAATATCTGTCTGGACCCGTTCACCCACATCGTCGATATCAATGAAGACATCGACATGCTGGTGCCC
GGCATCGCCAAGATGTGCTCGATGCAGCACACCCTGGAAGAGGTCCAGTACAAGGCCATCTCAGCCATGG
TCCTCAAGCTCTGGCGCGAATACGGCAATGAGCTGCGCATTACTGGCCTGCGCGACGCCTTCAAGAGCGG
CAGCATCGAAGAACTGGGTGTCGTTGGCGACCAGCGCATCAAGGACCTCGCCATCATGCTTAATCCCTAT
TCGCGTGGCGGGCAATACGAGCGCTTCTTCGAAGGCCGCAACAACATTGACTTTTCCAATGACTTCATCG
TCATCGAGAACGAGGAACTGAAACGCCGGCCCGACCTGCATGCGGTGGTCAATATTCTGCTGCTGCATCG
GATCACCGGCGAGATGTACCTCACCCGTAACCGGCGCAAGGTGCTCTTCGTCGACGAACTGAAGCAGCAG
TTGGGTGATATCGGTGCCGACGATCCGGTCAAGGCCGCCGTCATTGAGGAAGCGGCCCGGCGCGCCCGCA
AGTACGGCGGTGCGCTTGGCACCGCAACCCAGAGCGCCGACGACTTCTACGGCTCGACCCAGATGGAAGC
AGCCTTCAACTGCTCGGACTGGGTTTTCCTGCTGCGCCAGAAGCCGGAGTCCATCGAAATGCTCGACCGC
AAGGGCCGGCTGACCATGGACGAACCGAAGAAGCGGCTGTTGAACTCCCTGCGTACCGAGGCCGGCGTCT
TCTCCGAGTTGTACATCTCGTCGCCGGTCGGCGAAGGCGTCGCCCGTAACATCCTCGATCCGGCCACCCA
CCTGTTGTTCTCCAACAAGTTGGAAGACAACGCCCCGATCGACGAATTGCGCGCCCAGGGCCTATCCATC
GACGAGGCGATCAGTGAATTACTGCGCCATCGGGGGCATACGGTATGA
 Primer design