SecReT4
Protein ID: 71908270
T4SS name [ID]Tra_F [599]
Gene symbol-
Locus tagDaro_2657
StrainDechloromonas aromatica RCB
Repliconchromosome [GenBank: NC_007298] [Browse all T4SS(s) in this replicon]
Location [Strand]2851192..2851824 [+]
Producthypothetical protein
Component typeTraW_F
UniProt IDQ47CP4
KEGG IDdar:Daro_2657
PDB IDNA
Domain hit(s) vs Pfam TraW_N [PF12477], Evalue: 4e-10, Aligned region: 5..35
Protein Sequence: 210 a.a.     [Download]
>gi|71908270|ref|YP_285857.1| hypothetical protein Daro_2657 [Dechloromonas aromatica RCB]
MKRLIAIPSLLFALLVAPGARALDLGVIGPSYEISEPHLLQMIEQRLRDKERSGELKRLEEQARERGIAT
VKHPPPVAGLHSTETARTFYFDPSFTLDRNILGPRGELLFAAGTRKNPLEVVSLSRHLLFFDGRDARQVG
RARQLIAFYQGRVKPILVGGSYLELMKSWRMPVYFDQQGLLTRRLGITQVPALVSQEGLRLRIDELEIAP
 
Nucleotide Sequence: 633 bp     [Download]
>gi|71905642|ref|NC_007298.1|:2851192-2851824 Dechloromonas aromatica RCB, complete genome
ATGAAACGCCTGATCGCCATCCCGTCCCTGCTCTTCGCCCTGTTGGTCGCACCGGGCGCGCGAGCCCTTG
ATCTGGGCGTCATCGGGCCGAGCTATGAGATCAGCGAACCGCATCTGCTGCAAATGATCGAGCAACGATT
GCGCGACAAAGAGCGCAGCGGCGAACTCAAGCGCCTCGAAGAACAGGCCCGGGAACGGGGCATCGCAACC
GTAAAGCACCCACCGCCGGTCGCCGGCCTGCACTCGACCGAGACAGCCAGGACCTTCTACTTCGACCCGA
GCTTCACGCTCGATCGCAACATTCTCGGCCCCCGGGGCGAGTTGCTGTTTGCCGCCGGCACCCGCAAGAA
CCCGCTGGAAGTAGTGTCGCTGTCCCGGCACCTGCTCTTTTTCGATGGGCGCGACGCACGCCAGGTCGGC
CGTGCCCGGCAGTTGATCGCCTTCTACCAGGGGCGGGTCAAGCCGATCCTAGTCGGCGGCTCCTACCTCG
AGTTGATGAAGTCATGGCGCATGCCGGTCTATTTCGATCAGCAGGGTCTGCTCACCCGCCGCCTCGGCAT
CACTCAGGTGCCTGCCCTGGTATCGCAGGAAGGGCTGCGCCTGCGCATCGACGAGTTGGAGATCGCGCCA
TGA
 Primer design