SecReT4
Protein ID: 71908271
T4SS name [ID]Tra_F [599]
Gene symbol-
Locus tagDaro_2658
StrainDechloromonas aromatica RCB
Repliconchromosome [GenBank: NC_007298] [Browse all T4SS(s) in this replicon]
Location [Strand]2851821..2852849 [+]
Producthypothetical protein
Component typeTraU_F
UniProt IDQ47CP3
KEGG IDdar:Daro_2658
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 4e-78, Aligned region: 36..340
Protein Sequence: 342 a.a.     [Download]
>gi|71908271|ref|YP_285858.1| hypothetical protein Daro_2658 [Dechloromonas aromatica RCB]
MSQRCFVARLSTLLALLLGLSTLPALAAGTATCTGKFPNPITDICWSCILPISIGSAHIANFGDQEDTDN
PPSPVCSCLVNPIIGLSIGFWEPARHVEVVRKPFCLVSLGGVDLDPGIPAPEAARFTRPEGDGDGGGFYQ
AHYYLNPVMYWLDVVTDFPCLEKASFDLAYMTEVDPLWADDELTLILNPDAVLFANPVAIAACAADCVAA
SVGFGIREMFWCAGCQGGIYPLNGHVPYHLGGVRTAALMAQRLSAKMHRELVAWGWHGKDGLCGPYFEPV
MDKTAYKTQLTYPIPNTDKDGGRCCQPFGRTTVLWGAGKEYPVRGEDFAFMLFRKRNCCVGY
 
Nucleotide Sequence: 1029 bp     [Download]
>gi|71905642|ref|NC_007298.1|:2851821-2852849 Dechloromonas aromatica RCB, complete genome
ATGAGCCAACGCTGCTTCGTAGCCAGACTCTCTACCCTTCTGGCGCTGCTTCTCGGCCTCTCCACCCTAC
CGGCCTTGGCCGCCGGCACGGCCACCTGCACCGGCAAGTTTCCGAATCCGATCACCGATATCTGCTGGTC
CTGCATCCTGCCGATCAGCATTGGCAGTGCGCACATCGCCAACTTCGGCGACCAGGAGGATACCGACAAT
CCACCCAGTCCCGTGTGCAGTTGCCTGGTCAATCCGATCATCGGTCTGTCCATCGGTTTCTGGGAGCCGG
CGCGCCATGTCGAAGTGGTGCGCAAACCCTTCTGCCTCGTCTCGCTCGGCGGCGTAGACCTTGATCCAGG
CATCCCGGCTCCCGAGGCGGCCCGCTTTACCCGGCCGGAAGGCGATGGCGATGGTGGCGGTTTCTATCAG
GCGCATTACTACCTGAACCCGGTGATGTACTGGCTAGACGTGGTCACCGATTTTCCCTGCCTGGAGAAGG
CATCCTTCGATCTGGCCTACATGACCGAGGTCGATCCCTTGTGGGCCGACGACGAACTCACCCTGATCCT
CAATCCCGATGCCGTGCTGTTCGCCAATCCAGTCGCCATTGCCGCCTGCGCCGCCGATTGCGTCGCAGCC
TCGGTTGGCTTCGGCATACGCGAGATGTTCTGGTGCGCTGGTTGCCAAGGCGGCATCTATCCGCTCAATG
GGCACGTCCCCTACCACCTGGGTGGCGTCCGTACGGCCGCGCTGATGGCCCAGCGCTTGAGCGCCAAGAT
GCACCGTGAGTTGGTGGCCTGGGGCTGGCATGGCAAAGACGGCCTGTGCGGGCCGTACTTCGAGCCGGTG
ATGGACAAGACCGCCTACAAAACCCAACTCACCTACCCCATTCCCAACACCGACAAGGACGGCGGCCGCT
GCTGCCAGCCCTTCGGGCGGACCACCGTGCTCTGGGGGGCCGGCAAGGAATATCCGGTACGCGGCGAGGA
CTTCGCCTTCATGTTGTTTCGCAAAAGGAATTGCTGTGTCGGCTACTGA
 Primer design