SecReT4
Protein ID: 71908273
T4SS name [ID]Tra_F [599]
Gene symbol-
Locus tagDaro_2660
StrainDechloromonas aromatica RCB
Repliconchromosome [GenBank: NC_007298] [Browse all T4SS(s) in this replicon]
Location [Strand]2853604..2855724 [+]
Productconjugal transfer mating pair stabilization protein TraN
Component typeTraN_F
UniProt IDQ47CP1
KEGG IDdar:Daro_2660
PDB IDNA
Domain hit(s) vs Pfam TraN [PF06986], Evalue: 4.9e-43, Aligned region: 320..485
TraN [PF06986], Evalue: 4.9e-43, Aligned region: 574..656
Protein Sequence: 706 a.a.     [Download]
>gi|71908273|ref|YP_285860.1| conjugal transfer mating pair stabilization protein TraN [Dechloromonas aromatica RCB]
MRRLIIWITLFCFVTTQSAAIAGPFEEGTAAGQVANPVIRGTVNMPSASSAVPEYTTTPPETAYYGQPNL
SGAANVRLSTCAASANDPVCQAQDGALSSANTPRPAISAYDPAVTAARGIARNPSSALGSLADYYSGCTT
AEANTAAGTTTKVCNRYSGVGNYTTRRDLTVEINLQLSCTEGTWLAHGQVNRNGADYMVAEAQCQLRSDG
LQRFRFYAAGGQGACIGWQTVDLPTAPATQATYVTNLSPHWEGHCWSPFTVTMMPGSGCTAGTCNYIFQF
SGFGGLVKWNLPLSFVQPAMVQHETDVWVDKSAVLNADGRCTISTADTCVDGPATKTIEGRPVTRACWSY
ERTLTCTSGAPVDECAPLASSGCTPASSTCKQMNVGSGLCEITQDTYTCPVAAQTATTVSNCPANVYCLG
ANCFNTSYTNDADFARSMSLMEAGREAGVYLDTSKMQVFKGEGNRCRHRLLKNCCSSDSAGAGMTNQSLF
GTGSSLVYDVLMNSQNREFLYQGMQALLLGGGFSGSFTTYGITVAVNGTALPASSAVLYSGENLVIAFDP
WSLVIAVVIYIIMSMSSCNEEEGKLAMKEGAGLCHTVGTWCSSCFRVFGNCVSCLEHSTGKCCFNSKLAR
IVNEQGRVQVGKGWGSGESPDCSGFTIAQLQSLNFAAMDLTEFYASIVPTLPNASAIQGSNAARLTTCYY
GQGKCQ
 
Nucleotide Sequence: 2121 bp     [Download]
>gi|71905642|ref|NC_007298.1|:2853604-2855724 Dechloromonas aromatica RCB, complete genome
ATGCGCCGCCTGATCATCTGGATCACGCTGTTCTGCTTCGTCACGACGCAGAGCGCCGCTATCGCCGGGC
CGTTTGAAGAGGGCACCGCCGCCGGCCAGGTGGCCAACCCGGTCATTCGCGGCACGGTGAACATGCCCAG
CGCCTCAAGTGCCGTACCGGAATACACCACGACGCCACCGGAAACGGCGTATTACGGCCAGCCCAACCTG
TCGGGCGCAGCCAATGTCCGTCTCAGTACCTGCGCGGCCAGCGCCAACGATCCAGTCTGCCAGGCCCAGG
ACGGGGCGCTGAGCTCGGCCAACACGCCCCGCCCGGCGATCTCCGCCTACGATCCGGCAGTCACTGCGGC
CCGCGGCATCGCCCGCAATCCGTCGAGCGCCTTGGGCAGCCTGGCCGATTATTACTCCGGCTGCACGACC
GCCGAGGCCAACACTGCGGCAGGCACCACGACCAAGGTCTGCAACCGCTACAGCGGTGTCGGCAACTACA
CGACACGGCGCGATCTGACGGTTGAGATAAATCTCCAGCTTAGTTGTACTGAAGGCACCTGGTTGGCTCA
TGGTCAGGTCAATCGCAACGGCGCCGACTACATGGTCGCGGAAGCGCAATGCCAACTGCGCAGCGATGGG
CTGCAACGTTTTCGTTTTTATGCGGCCGGTGGGCAAGGGGCCTGCATCGGCTGGCAGACCGTGGACCTGC
CGACCGCACCGGCGACCCAGGCCACCTATGTCACCAATCTATCCCCCCATTGGGAGGGCCATTGCTGGAG
CCCGTTCACGGTCACCATGATGCCGGGTTCAGGCTGCACCGCCGGGACCTGCAACTACATATTTCAGTTC
AGTGGATTTGGCGGGCTTGTGAAGTGGAACTTGCCCTTGTCCTTCGTCCAACCCGCCATGGTGCAACACG
AGACCGATGTCTGGGTCGACAAGAGTGCCGTGCTGAATGCTGACGGACGGTGCACCATCAGCACCGCCGA
CACCTGTGTCGACGGCCCGGCCACCAAGACCATCGAAGGCCGCCCCGTGACCCGCGCCTGCTGGTCCTAT
GAGCGCACCCTGACCTGCACTTCGGGCGCACCGGTCGACGAGTGCGCGCCGCTGGCCAGCAGCGGCTGCA
CGCCAGCCAGCAGCACCTGCAAGCAGATGAATGTCGGCAGCGGGCTGTGTGAGATCACCCAGGACACCTA
TACCTGCCCGGTTGCAGCGCAGACCGCAACCACCGTTTCGAACTGCCCGGCCAACGTCTATTGCCTGGGT
GCGAACTGCTTCAACACCAGTTACACCAACGATGCCGACTTTGCCCGTTCGATGTCGCTGATGGAAGCTG
GACGCGAAGCTGGCGTGTATCTCGACACCAGCAAAATGCAGGTCTTCAAGGGCGAAGGCAACCGCTGCCG
CCACCGCCTGCTGAAGAACTGTTGCAGTTCAGATTCGGCTGGCGCCGGCATGACCAATCAGAGCCTGTTC
GGCACCGGCTCAAGTTTGGTCTACGACGTGCTGATGAATTCCCAGAACCGTGAGTTTCTTTACCAGGGCA
TGCAGGCCTTACTGCTGGGTGGCGGTTTTAGCGGAAGCTTCACGACCTATGGCATCACAGTCGCTGTCAA
CGGGACGGCACTACCGGCCAGTTCGGCCGTGCTCTACTCCGGCGAAAACCTGGTGATTGCCTTCGACCCC
TGGTCGCTGGTCATTGCGGTGGTGATCTACATCATCATGTCGATGTCCTCCTGCAACGAAGAAGAAGGCA
AACTCGCCATGAAGGAAGGGGCCGGCCTGTGCCATACCGTCGGCACCTGGTGCTCCTCCTGCTTCCGCGT
CTTCGGCAATTGCGTCTCCTGCCTCGAACACAGTACCGGTAAGTGTTGCTTCAACAGCAAACTGGCCCGC
ATCGTCAATGAGCAGGGCCGCGTGCAAGTCGGCAAGGGCTGGGGCTCAGGCGAAAGTCCCGACTGCTCAG
GGTTCACCATCGCACAACTCCAGAGCCTCAATTTTGCGGCCATGGACCTGACCGAGTTCTACGCTTCCAT
CGTTCCGACGCTGCCCAATGCCAGCGCAATTCAGGGCAGCAATGCCGCGCGCCTGACAACCTGCTACTAC
GGACAGGGGAAGTGCCAATGA
 Primer design