SecReT4
Protein ID: 71908275
T4SS name [ID]Tra_F [599]
Gene symbol-
Locus tagDaro_2662
StrainDechloromonas aromatica RCB
Repliconchromosome [GenBank: NC_007298] [Browse all T4SS(s) in this replicon]
Location [Strand]2856104..2856970 [+]
Producthypothetical protein
Component typeTraF_F
UniProt IDQ47CN9
KEGG IDdar:Daro_2662
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 3.1e-67, Aligned region: 41..262
Thioredoxin_8 [PF13905], Evalue: 2.8e-06, Aligned region: 169..208
Thioredoxin_2 [PF13098], Evalue: 1.4e-05, Aligned region: 168..260
AhpC-TSA [PF00578], Evalue: 5.1e-05, Aligned region: 161..208
Protein Sequence: 288 a.a.     [Download]
>gi|71908275|ref|YP_285862.1| hypothetical protein Daro_2662 [Dechloromonas aromatica RCB]
MTIRNRPALPLLLLTFTVILGINSAAAQDAASRYWSDSWRGWHFYEAPAPEEIEHPLLPGKATATAPPAQ
PSRAPELVEFERLQKTLEETRNIAIMRPSEANVRRYMELESLVVARASYFADVAQRVAWATPQLDPTLQG
RPVNAKALEVFDQAELVDRSRAIADLGKDHVLFFFYRSDCPYCHAFAPTLAAFQARHGIQVVAISVDGGP
LPSFPNARPDNGIATTLKVSQVPAVFLAQPFTGKISPIGFGVLSESQLLERIATVSAPQAEVMLPTTTQG
LALPLEAP
 
Nucleotide Sequence: 867 bp     [Download]
>gi|71905642|ref|NC_007298.1|:2856104-2856970 Dechloromonas aromatica RCB, complete genome
ATGACGATCCGTAACCGCCCCGCCCTCCCGCTGCTGCTGCTGACCTTCACCGTGATCCTCGGAATCAATA
GCGCAGCAGCCCAGGATGCAGCCTCCCGCTACTGGTCCGACAGTTGGCGCGGCTGGCATTTCTATGAAGC
ACCGGCACCAGAAGAGATCGAACATCCATTACTGCCGGGCAAGGCCACAGCAACTGCACCGCCCGCTCAA
CCATCGCGGGCACCTGAACTGGTTGAATTCGAACGCCTCCAGAAAACGCTGGAAGAGACGCGCAACATTG
CCATCATGCGCCCGAGCGAAGCCAATGTCCGGCGCTACATGGAACTGGAGTCCCTGGTCGTCGCCCGCGC
TTCCTATTTCGCTGACGTCGCGCAGCGCGTTGCCTGGGCCACGCCCCAACTCGACCCGACCCTGCAGGGC
CGCCCGGTCAATGCCAAGGCACTGGAAGTCTTCGACCAGGCCGAGTTGGTGGATCGTTCGCGCGCCATTG
CCGATCTGGGCAAGGATCACGTGCTGTTCTTTTTCTACCGCTCGGACTGCCCGTATTGCCATGCCTTCGC
GCCGACGCTGGCGGCTTTCCAGGCCCGTCACGGTATCCAGGTTGTCGCTATCAGCGTGGATGGGGGTCCG
TTGCCAAGTTTCCCCAATGCCCGCCCGGACAACGGCATTGCCACCACCCTGAAGGTCAGCCAGGTGCCCG
CTGTTTTTCTGGCCCAGCCCTTCACCGGAAAGATCTCTCCCATTGGCTTCGGGGTGCTCTCGGAATCTCA
GTTACTCGAACGCATTGCCACTGTGTCCGCTCCGCAAGCCGAGGTCATGCTGCCTACAACCACGCAAGGT
CTCGCCCTACCCCTGGAGGCGCCATGA
 Primer design