SecReT4
Protein ID: 71908276
T4SS name [ID]Tra_F [599]
Gene symbol-
Locus tagDaro_2663
StrainDechloromonas aromatica RCB
Repliconchromosome [GenBank: NC_007298] [Browse all T4SS(s) in this replicon]
Location [Strand]2856967..2858415 [+]
Producthypothetical protein
Component typeTraH_F
UniProt IDQ47CN8
KEGG IDdar:Daro_2663
PDB IDNA
Domain hit(s) vs Pfam TraH [PF06122], Evalue: 8e-98, Aligned region: 37..396
Protein Sequence: 482 a.a.     [Download]
>gi|71908276|ref|YP_285863.1| hypothetical protein Daro_2663 [Dechloromonas aromatica RCB]
MNHYDHPHLRRSAATFLALLLAIPSFQLQAGDLNSEVNNMFNNLGAIGNYTAPGAFRGQTFNTYTGGSLM
MRSPNKVYQLAAIQFPSAKAGCGGIDVFGGSFSHISATEFKNMLKNITAALPGIAFQLALEAVSPLLGGL
TKWAKGLETWINNARINSCETAKAIVSTAAESIGYSSQETCADLAIEMGMESDRDAARRRCATDRPSILS
SARSSADPKVKNKAPFVGNLTWKALQYTGAYLDDPERELIMSLVGTVIYYPEESARDPEPIAPTLTSISQ
LLYGQGAAAGTDVVQHVLKCNDYTNCDVVTLNTTYTHTPFTAKVEAIMRSIAEKITTRTAIPNNSTEVGF
VNQTTEPVYKMLSIGTSIPGSGLADSLIAQYRDVIAADYAYVFLERNLRLGMAALDKNYTLQQSQREQAN
QVRQRAQAMLTQLSQEKNLLYQKVGSFRAVSNHLEQLERQLRSSMPQHVMDMLGQQAAYLSQ
 
Nucleotide Sequence: 1449 bp     [Download]
>gi|71905642|ref|NC_007298.1|:2856967-2858415 Dechloromonas aromatica RCB, complete genome
ATGAACCATTACGACCATCCTCATTTGCGGCGTAGCGCTGCCACCTTCCTGGCGCTGCTGCTGGCGATCC
CGTCCTTCCAACTACAGGCCGGCGACCTCAACAGCGAGGTGAACAACATGTTCAACAATCTGGGCGCCAT
CGGCAACTACACCGCCCCCGGTGCCTTCCGTGGCCAGACCTTCAATACCTACACCGGCGGCAGCCTGATG
ATGCGTTCGCCGAACAAGGTTTATCAGCTGGCCGCCATCCAGTTCCCCAGCGCCAAGGCCGGCTGTGGTG
GCATCGATGTCTTTGGCGGCTCCTTCTCGCACATTTCGGCAACCGAGTTCAAGAACATGCTGAAGAACAT
CACGGCCGCCCTGCCGGGGATCGCTTTTCAGCTCGCTCTGGAGGCGGTCTCGCCCCTGCTCGGCGGACTG
ACCAAGTGGGCCAAGGGGCTGGAGACCTGGATCAACAATGCCCGCATCAATTCCTGCGAAACCGCCAAGG
CCATTGTCAGCACGGCGGCCGAATCGATTGGCTACAGTTCGCAGGAAACCTGCGCCGATCTGGCCATCGA
AATGGGGATGGAAAGCGACCGTGATGCGGCGCGTCGGCGCTGTGCGACGGATCGGCCGAGCATTTTGTCT
TCAGCACGCTCCTCGGCCGACCCGAAGGTGAAAAACAAGGCACCTTTCGTCGGCAACCTGACCTGGAAAG
CCTTGCAGTACACCGGTGCTTATCTGGATGACCCGGAGCGTGAATTGATCATGAGCCTGGTCGGCACGGT
CATCTATTACCCGGAAGAATCGGCCCGTGACCCCGAGCCGATTGCCCCGACGCTGACCTCGATCAGCCAG
TTGCTCTACGGCCAGGGTGCGGCCGCTGGTACGGATGTCGTGCAGCATGTCTTGAAGTGCAACGACTACA
CAAACTGTGACGTAGTCACCTTGAACACCACGTACACCCATACGCCCTTTACCGCCAAGGTCGAAGCGAT
CATGCGCTCCATTGCCGAGAAAATCACGACGCGCACCGCCATTCCCAATAACTCGACCGAGGTCGGCTTC
GTGAATCAGACCACCGAACCGGTCTACAAGATGTTGTCCATCGGTACCAGCATCCCGGGATCGGGCTTGG
CCGACAGCCTGATCGCCCAGTACCGCGATGTGATTGCCGCCGACTACGCCTATGTTTTTCTTGAACGCAA
TCTGCGTCTGGGCATGGCTGCGCTGGACAAGAACTACACCTTGCAGCAGTCGCAACGGGAGCAGGCCAAC
CAGGTCCGCCAGCGGGCGCAGGCCATGCTCACGCAACTCTCCCAGGAAAAGAACCTGCTCTACCAGAAGG
TCGGCTCCTTCCGGGCGGTATCGAACCACCTGGAGCAACTCGAACGCCAACTGCGCTCCAGCATGCCGCA
ACACGTGATGGACATGCTCGGCCAGCAGGCCGCCTATCTGTCGCAATAG
 Primer design