SecReT4
Protein ID: 71908277
T4SS name [ID]Tra_F [599]
Gene symbol-
Locus tagDaro_2664
StrainDechloromonas aromatica RCB
Repliconchromosome [GenBank: NC_007298] [Browse all T4SS(s) in this replicon]
Location [Strand]2858449..2861223 [+]
Producthypothetical protein
Component typeTraG_F
UniProt IDQ47CN7
KEGG IDdar:Daro_2664
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 3.2e-110, Aligned region: 3..469
Protein Sequence: 924 a.a.     [Download]
>gi|71908277|ref|YP_285864.1| hypothetical protein Daro_2664 [Dechloromonas aromatica RCB]
MWEIYAYQNADSLFGVFNAAAAIHASGDYAAALAAVAFCGFVAALIAYAFAPEKLQGWKWLGTVVLVFSV
LIVPKVTVGIVDKTGGSAVKIVGNVPFGVAALGGITSTIGNTLTSLFETAFQVIPGVGALPVELSYQQNG
LMFGNRLIRETGNVVFQDPAFRTDLINFIHNCTTYDLIDGTLDPAVFSASDDVWPLMASPNPARFSTLTG
AGGSVGVDTCPNVYLSLNGRLPAQISRIQGRLAFQLNPTLPGAAAAAAIAGQIQQAYLKNSIASAAATAA
DIIRQNAMLNALEDTSKIVGQKVNDPAAMVLAVGRAQAVAQQNASWLNYGKVAEQALPVFRNVVEAVTYA
MFPLFVMLLLLTSGRETMLAFKGYAAVLIWIQLWPPLYAILNYMASIYAAYDLAAAADLGTGGKSLALQT
ASTIYSRAISGEAVVGYLAISIPFIAWAALKRMENFGTALVGGLSGLQGMISGGTSAATVGNVSMGNVGM
DQMQLAPNRTSAFMGSWQNDLSGNTFSSNALTGRTAVSLLRNQGFASRMVSMRVSEQDVAQASKQVDAAQ
NESVAANTERSAILSEAFSRGLSKLRSSRSSSGSTSSSFEQMGETLNEMNQITKSVAENTGLSQAQVARI
AFGAAGHVGVNAGFAGGQLRASAEKSYLSSLSSQEQKALASMSGEQLVAFKQFGDRLSRDSSFLNALSSD
SRDAHEISSRLGSTVARSERAEASLAERTSFAERVSSAYEKGESISIDIAQDPHNLEMFMRYAEEYGGDS
AAAHALMESELARQSLRPNRVFSDGTALPASFGNIRDQHIQQQGNTALTPDIIGQHQSNRDQISHFKNAA
PSRGSVPAAPPIREEVHARGNQIRSDAVSHRADFDVKAEIIKTDNGTLASKKSLLVQSGKQVGRDAGATF
DNAKEAVNDLLKKK
 
Nucleotide Sequence: 2775 bp     [Download]
>gi|71905642|ref|NC_007298.1|:2858449-2861223 Dechloromonas aromatica RCB, complete genome
ATGTGGGAAATATACGCTTACCAGAACGCCGACAGTTTGTTCGGCGTCTTCAATGCCGCGGCGGCGATCC
ACGCCTCGGGCGACTACGCCGCTGCCCTGGCGGCTGTGGCCTTCTGCGGCTTTGTTGCGGCCCTGATTGC
CTACGCTTTTGCCCCCGAGAAGTTGCAGGGCTGGAAGTGGTTGGGCACTGTTGTGCTGGTTTTCTCGGTG
TTGATCGTGCCCAAGGTCACGGTGGGCATTGTGGATAAGACCGGCGGTTCGGCCGTCAAGATCGTCGGCA
ATGTGCCTTTCGGGGTGGCCGCGCTGGGCGGCATCACCAGCACGATCGGCAACACGCTGACCAGTCTGTT
CGAAACGGCATTCCAGGTTATCCCGGGCGTCGGAGCCCTTCCGGTCGAATTGAGCTACCAGCAGAACGGC
CTGATGTTCGGCAACCGGCTGATCCGCGAGACCGGCAATGTGGTTTTCCAGGATCCGGCTTTCCGCACCG
ATCTGATCAACTTCATCCACAACTGCACGACTTACGACCTGATCGACGGCACGCTCGATCCGGCAGTCTT
TTCTGCATCGGACGATGTCTGGCCGCTGATGGCCTCCCCCAATCCGGCGCGCTTCAGCACGCTGACTGGC
GCTGGCGGTAGTGTCGGCGTCGATACCTGCCCCAATGTTTATCTGAGCCTCAATGGCCGCTTGCCGGCCC
AGATCAGCCGCATCCAGGGGCGCCTGGCTTTTCAACTCAACCCGACCTTGCCCGGTGCCGCTGCTGCGGC
GGCCATCGCCGGACAGATTCAGCAGGCCTATCTAAAGAACAGCATTGCCAGCGCGGCGGCGACGGCGGCC
GACATCATCCGGCAGAACGCCATGCTCAACGCGCTTGAGGACACCAGCAAGATCGTCGGTCAGAAGGTTA
ACGACCCGGCGGCGATGGTGCTGGCGGTCGGCCGCGCCCAGGCGGTGGCCCAGCAGAACGCTTCCTGGCT
CAACTACGGCAAGGTTGCAGAGCAAGCCTTGCCTGTTTTTAGAAACGTGGTCGAGGCGGTAACCTACGCG
ATGTTCCCGCTCTTCGTGATGCTCCTGCTGCTCACCAGCGGACGGGAGACAATGCTCGCCTTCAAGGGCT
ATGCGGCCGTGTTGATCTGGATTCAATTGTGGCCGCCGCTCTATGCAATCCTGAACTACATGGCCTCGAT
CTATGCGGCCTACGACCTTGCCGCAGCGGCCGACCTCGGAACGGGGGGCAAATCGCTGGCACTGCAAACT
GCGTCCACGATCTATTCGCGGGCAATCTCGGGGGAGGCCGTCGTCGGTTACCTCGCCATCAGCATTCCTT
TCATTGCCTGGGCCGCCCTGAAGCGCATGGAAAACTTCGGGACTGCATTGGTCGGTGGCTTGTCGGGGCT
ACAAGGGATGATCTCGGGCGGCACCTCAGCCGCCACCGTTGGTAACGTCTCGATGGGGAACGTCGGCATG
GACCAGATGCAACTGGCACCCAACCGTACGTCGGCGTTCATGGGCAGTTGGCAGAACGACCTCTCCGGAA
ACACTTTCTCGTCGAATGCGCTGACCGGGCGTACGGCCGTCAGCCTACTGCGCAATCAGGGGTTTGCTTC
CCGGATGGTTTCGATGCGAGTGTCTGAGCAGGATGTGGCCCAAGCCAGCAAGCAGGTCGATGCAGCTCAA
AACGAGAGTGTCGCAGCCAATACCGAACGCTCAGCCATTCTGTCAGAGGCATTCTCGCGAGGATTGAGCA
AATTGCGCTCATCGCGTAGTAGCAGCGGCTCTACGTCCAGCAGTTTCGAGCAAATGGGAGAAACGTTGAA
CGAGATGAATCAAATTACCAAGAGTGTCGCGGAAAATACAGGACTGAGCCAAGCACAGGTCGCACGCATC
GCTTTCGGTGCAGCCGGGCATGTCGGCGTCAACGCAGGTTTCGCTGGAGGCCAGTTGAGGGCAAGTGCGG
AGAAATCCTATTTGTCGAGTTTATCGTCACAGGAACAGAAAGCGCTGGCCAGCATGAGCGGAGAGCAGTT
GGTAGCATTCAAGCAATTTGGCGATCGGTTATCCCGAGATAGCAGTTTCTTGAATGCACTCTCCAGCGAC
TCCCGCGACGCCCATGAAATATCGTCCCGACTCGGATCAACTGTCGCGCGCTCCGAACGAGCCGAAGCAA
GCCTTGCCGAACGCACCAGCTTTGCGGAGCGAGTATCCTCGGCCTATGAAAAAGGCGAGTCCATTTCCAT
CGACATTGCACAGGACCCCCACAATCTTGAGATGTTTATGCGCTACGCCGAGGAATACGGCGGGGACAGC
GCAGCGGCTCATGCCTTGATGGAATCGGAATTGGCACGCCAATCTCTACGCCCGAACCGGGTGTTTTCTG
ACGGGACGGCACTGCCTGCCTCTTTTGGGAACATTCGGGATCAACATATACAGCAGCAGGGCAATACTGC
GCTGACACCCGACATCATCGGTCAGCATCAATCCAATCGGGATCAAATCTCACACTTTAAGAATGCCGCC
CCATCCCGAGGGAGCGTACCCGCGGCACCACCAATCCGAGAGGAAGTACATGCCCGCGGCAATCAAATTC
GCTCAGACGCTGTATCGCACCGCGCTGACTTCGACGTCAAGGCTGAGATCATCAAGACGGATAACGGAAC
GCTCGCATCGAAGAAATCGCTGCTTGTGCAATCGGGCAAACAGGTAGGCAGAGACGCAGGAGCGACATTC
GACAATGCCAAAGAGGCGGTGAACGACTTGCTTAAGAAAAAATAA
 Primer design