SecReT4
Protein ID: 72384306
T4SS name [ID]Trb [69]
Gene symbol-
Locus tagReut_D6504
StrainRalstonia eutropha JMP134
Repliconplasmid 1 [GenBank: NC_007337] [Browse all T4SS(s) in this replicon]
Location [Strand]59690..60001 [+]
Productconjugal transfer protein TrbD
Component typeTrbD
UniProt IDQ6UP61
KEGG IDreu:Reut_D6504
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 2.6e-26, Aligned region: 1..87
Protein Sequence: 103 a.a.     [Download]
>gi|72384306|ref|YP_293659.1| conjugal transfer TrbD [Ralstonia eutropha JMP134]
MALRAIPIRRAGNRENLFMGGDRELVMFSGLLAGALIFSAQEVRATVFGIALWFGALFALRLMAKADPKL
RHVYLRHRRYKPYYPARSTPFRDNTPSQGKQYK
 
Nucleotide Sequence: 312 bp     [Download]
>gi|72384244|ref|NC_007337.1|:59690-60001 Ralstonia eutropha JMP134 plasmid 1, complete sequence
ATGGCTCTGCGCGCGATCCCCATCCGTAGGGCCGGCAACCGAGAAAACCTGTTCATGGGCGGGGATCGTG
AGCTGGTGATGTTCTCGGGCCTGCTGGCCGGCGCGCTGATTTTCAGCGCCCAAGAAGTGAGGGCAACGGT
GTTCGGCATCGCCTTGTGGTTCGGCGCGCTCTTCGCGCTGCGCCTCATGGCGAAGGCCGATCCGAAGCTG
CGACACGTGTACCTGCGGCACCGCCGGTACAAGCCGTACTACCCGGCTCGCAGCACGCCCTTCCGTGACA
ACACGCCGAGTCAAGGGAAGCAATACAAATGA
 Primer design