SecReT4
Protein ID: 72384307
T4SS name [ID]Trb [69]
Gene symbol-
Locus tagReut_D6505
StrainRalstonia eutropha JMP134
Repliconplasmid 1 [GenBank: NC_007337] [Browse all T4SS(s) in this replicon]
Location [Strand]59998..62556 [+]
Productconjugal transfer protein TrbE
Component typeTrbE
UniProt IDQ6UP60
KEGG IDreu:Reut_D6505
PDB IDNA
Domain hit(s) vs Pfam CagE_TrbE_VirB [PF03135], Evalue: 1.7e-56, Aligned region: 218..431
AAA_10 [PF12846], Evalue: 2.9e-29, Aligned region: 489..770
Protein Sequence: 852 a.a.     [Download]
>gi|72384307|ref|YP_293660.1| CagE, TrbE, VirB component of type IV transporter system [Ralstonia eutropha JMP134]
MIEAIAIAIAVLGAVLLLILFARIRAVDAELKLKKHRAKDAGLADLLNYAAVVDDGVIVGKNGSFMAAWL
YKGDDNASSTEEQREMVSFRINQALAGLGNGWMVHVDAVRRPAPNYSERGVSSFPDSVSFAIDEERRRLF
EGLGAMFEGYFVLTVTWFPPVLAQRKFVELMFDDDAVAPDHTARTTGLIAQFKREITSLESRLSSAVKMT
RLRGQKVVSEEGREVTHDDFLSWLQFCVTGLHHPVMLPSNPMYLDAVIGGQELWGGVVPKIGRKFIQVVA
IEGFPLESTPGVLSALAELPSEYRWSSRFIFMDQHESLKHLDKFRKKWKQKIRGFFDQVFNTNTGSINQD
AAAMVGDAEAAIAEVNSGLVAAGYYTSVVVLMDEDRERLAASALLVEKAVNRLAFAARIETINTLDAYLG
SLPGHGVENVRRPLINTMNLADLLPTSSIWTGSATAPCPMYPPLSPALMHCVTVGATPFRLNLHVRDLGH
TFMFGPTGAGKSTHLGIIAAQLRRYAGMSIYAFDKGMSMYPLAAGIRAATKGKSGLHFTVAADDDRLAFC
PLQFLETKGDRAWAMEWIDTILALNGVNTTPAQRNEIGNAIMSMHASGARTLSEFSVTIQDEAIREAIKQ
YTVDGSMGHLLDAEEDGLSLSDFTVFEIEELMNLGEKFALPVLLYLFRRIERALKGQPSVIILDEAWLML
GHPAFRAKIREWLKVLRKANCLVLMATQSLSDAANSGILDVIVESTATKIFLPNVYARDEDTSALYRRMG
LNARQIEILATAIPKRQYYYVSENGRRLYDLALGPMALAFVGASDKESVATIKSLEAKFGHEWVHEWLAG
RGLNLNDYLEAA
 
Nucleotide Sequence: 2559 bp     [Download]
>gi|72384244|ref|NC_007337.1|:59998-62556 Ralstonia eutropha JMP134 plasmid 1, complete sequence
ATGATCGAAGCAATCGCAATTGCCATTGCTGTGCTCGGTGCGGTTCTGTTGCTCATCCTCTTTGCCCGCA
TCCGGGCTGTCGATGCCGAGCTGAAGCTCAAGAAGCATCGCGCCAAGGATGCCGGCCTGGCCGATCTGCT
CAATTACGCCGCCGTGGTCGATGACGGCGTGATCGTGGGCAAGAACGGCTCCTTTATGGCCGCCTGGCTG
TACAAGGGTGATGACAACGCCAGCAGCACCGAGGAACAGCGGGAAATGGTGTCGTTCCGCATCAACCAGG
CCCTGGCGGGCCTGGGGAACGGCTGGATGGTGCATGTCGATGCTGTGCGTCGGCCTGCGCCGAACTACTC
GGAGCGGGGCGTGTCATCGTTCCCCGACTCCGTTTCCTTCGCCATTGACGAGGAACGCCGGCGCTTGTTC
GAGGGCCTGGGCGCGATGTTCGAGGGCTACTTTGTCCTGACCGTCACGTGGTTCCCGCCAGTGCTGGCCC
AGCGCAAGTTTGTCGAACTCATGTTCGATGACGATGCGGTGGCTCCCGACCATACGGCGCGCACTACGGG
CCTGATTGCGCAGTTCAAGCGCGAGATCACCAGCCTGGAATCGCGCCTGTCCTCGGCGGTCAAGATGACG
CGCCTGCGCGGCCAAAAAGTCGTGTCGGAAGAGGGCAGGGAAGTCACGCACGATGACTTCCTGAGCTGGT
TGCAGTTCTGCGTGACGGGCCTCCATCACCCGGTCATGCTGCCCAGCAATCCGATGTACCTCGATGCGGT
AATCGGCGGGCAAGAGCTGTGGGGCGGCGTCGTGCCCAAGATCGGGCGCAAGTTCATCCAGGTGGTCGCC
ATCGAAGGCTTCCCCTTGGAGTCAACGCCTGGGGTGCTCTCGGCCCTGGCCGAGCTGCCCAGCGAATACC
GCTGGTCGAGCCGCTTCATCTTCATGGATCAGCACGAGTCCTTGAAGCACCTGGACAAGTTCCGCAAGAA
GTGGAAGCAGAAGATTCGCGGCTTCTTCGATCAGGTGTTCAACACGAATACCGGCTCGATCAACCAGGAC
GCGGCCGCGATGGTCGGCGACGCCGAGGCGGCCATCGCCGAGGTCAACAGCGGCTTGGTGGCGGCCGGCT
ACTACACCAGCGTAGTCGTGCTGATGGACGAGGATCGGGAGCGCCTGGCGGCCTCCGCGCTCCTGGTCGA
GAAGGCCGTCAACCGCCTGGCCTTCGCGGCCCGTATCGAGACGATCAACACGCTCGATGCGTACCTGGGC
AGCTTGCCCGGCCACGGCGTCGAGAACGTGCGCCGGCCGCTCATCAACACGATGAACCTGGCCGACCTGC
TGCCGACAAGCTCGATCTGGACGGGCAGCGCCACGGCTCCGTGCCCGATGTACCCGCCGCTGTCGCCGGC
GCTCATGCACTGCGTGACGGTGGGCGCTACGCCGTTCCGCCTGAACCTGCACGTGCGCGACCTGGGCCAC
ACCTTCATGTTCGGCCCGACCGGCGCAGGCAAATCGACGCACCTGGGCATCATCGCCGCGCAGCTCCGTC
GCTACGCCGGCATGTCGATCTACGCCTTCGACAAGGGCATGTCGATGTACCCACTCGCGGCCGGCATCCG
CGCGGCCACGAAGGGCAAGAGCGGCCTGCATTTCACGGTGGCCGCCGACGATGACCGCCTGGCGTTCTGC
CCGCTCCAGTTCCTCGAAACGAAGGGGGATAGGGCCTGGGCGATGGAGTGGATCGACACCATCCTGGCGT
TGAACGGCGTCAACACCACGCCGGCGCAGCGCAACGAGATCGGCAACGCGATCATGAGCATGCACGCCAG
CGGCGCGCGCACGCTCTCCGAGTTCTCGGTGACGATTCAGGACGAGGCGATCCGCGAGGCCATCAAGCAG
TACACGGTGGACGGCTCGATGGGCCACCTGCTCGACGCCGAAGAGGACGGCCTGTCGCTGTCCGACTTCA
CGGTGTTCGAGATCGAAGAGCTGATGAACCTGGGCGAGAAGTTCGCGCTGCCGGTGCTGCTCTACCTGTT
CCGCCGCATCGAGCGCGCACTGAAAGGCCAGCCCTCCGTCATCATCCTGGACGAAGCCTGGTTGATGCTG
GGCCACCCCGCGTTCCGCGCCAAGATCAGGGAATGGCTCAAGGTGCTGCGCAAGGCCAACTGCCTTGTGC
TGATGGCGACGCAAAGCCTCTCCGACGCGGCCAACTCGGGCATCTTGGACGTGATCGTGGAATCGACCGC
GACCAAGATTTTCCTGCCTAACGTCTACGCCAGGGATGAGGACACATCGGCGCTCTATCGCCGTATGGGC
CTCAACGCGCGTCAGATCGAAATCCTGGCGACTGCCATTCCGAAGCGTCAGTACTACTACGTCTCGGAGA
ACGGCCGCCGTCTCTATGACCTTGCCCTGGGGCCGATGGCCCTGGCCTTCGTCGGTGCGTCCGACAAGGA
ATCGGTCGCCACCATCAAGAGCCTCGAAGCCAAGTTCGGCCACGAATGGGTGCATGAGTGGCTGGCCGGC
CGTGGGCTGAATCTCAACGACTACCTGGAGGCCGCATGA
 Primer design