SecReT4
Protein ID: 72384308
T4SS name [ID]Trb [69]
Gene symbol-
Locus tagReut_D6506
StrainRalstonia eutropha JMP134
Repliconplasmid 1 [GenBank: NC_007337] [Browse all T4SS(s) in this replicon]
Location [Strand]62553..63335 [+]
Productconjugal transfer protein TrbF
Component typeTrbF
UniProt IDQ6UP59
KEGG IDreu:Reut_D6506
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 4.4e-59, Aligned region: 46..258
Protein Sequence: 260 a.a.     [Download]
>gi|72384308|ref|YP_293661.1| conjugal transfer protein [Ralstonia eutropha JMP134]
MSIADTLKGLIFKKPANSAEPRDPRRSKEPLAGGRRAGEAENPYLAARRTWNDHVGSVVSQRQTWQVIGI
LSLLIALAGVGGVIHIGSQSKFIPYVVEVDKLGQTVAAGPVQAAGKADPRVIHAAVADWMSCARMVSPDV
ALQRKCVFKAYSMLAPNDPATPKMNEWLNGTPDSSPFKRAEKEMVSVEIKTVIPQTPDTWQVEWVETTRD
RQGTLKGQPVTWRALVTTYIAEVTPNTTDEQLRNNPLSIYVRDYSWSRIQ
 
Nucleotide Sequence: 783 bp     [Download]
>gi|72384244|ref|NC_007337.1|:62553-63335 Ralstonia eutropha JMP134 plasmid 1, complete sequence
ATGAGCATCGCCGACACCCTCAAGGGCTTGATCTTCAAGAAGCCCGCCAACTCCGCCGAGCCGCGCGATC
CGCGCCGCTCGAAGGAACCGCTCGCCGGCGGCCGCCGTGCGGGCGAGGCCGAGAACCCCTACCTGGCCGC
GCGCCGCACCTGGAACGATCACGTGGGCAGCGTCGTCTCGCAGCGCCAAACCTGGCAGGTGATAGGCATC
CTGTCGCTGTTGATCGCGCTGGCCGGCGTGGGTGGCGTGATCCACATCGGCAGCCAGTCGAAGTTCATCC
CCTACGTGGTCGAGGTGGACAAGCTGGGCCAGACGGTGGCCGCCGGCCCGGTGCAGGCCGCAGGGAAGGC
CGATCCGCGTGTCATCCACGCCGCCGTTGCGGACTGGATGAGCTGCGCGCGCATGGTGTCGCCTGACGTG
GCCTTGCAGCGCAAGTGCGTGTTCAAGGCGTACTCGATGCTCGCCCCCAACGATCCGGCGACGCCAAAGA
TGAACGAGTGGTTGAACGGCACGCCCGATTCCAGCCCGTTCAAGCGCGCCGAGAAGGAAATGGTCAGCGT
CGAGATCAAGACCGTCATCCCGCAAACGCCCGACACCTGGCAAGTCGAGTGGGTGGAAACCACGCGCGAC
CGCCAAGGCACGCTGAAAGGTCAGCCCGTCACCTGGCGCGCGCTCGTGACTACCTACATCGCCGAGGTCA
CGCCCAACACCACCGATGAGCAACTGCGGAACAACCCGTTGAGCATCTACGTGCGTGATTACTCCTGGTC
CCGCATCCAATGA
 Primer design