SecReT4
Protein ID: 72384309
T4SS name [ID]Trb [69]
Gene symbol-
Locus tagReut_D6507
StrainRalstonia eutropha JMP134
Repliconplasmid 1 [GenBank: NC_007337] [Browse all T4SS(s) in this replicon]
Location [Strand]63353..64252 [+]
Productconjugal transfer protein TrbG
Component typeTrbG
UniProt IDQ46M25
KEGG IDreu:Reut_D6507
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 1.4e-66, Aligned region: 73..298
Protein Sequence: 299 a.a.     [Download]
>gi|72384309|ref|YP_293662.1| conjugal transfer protein TrbG/VirB9/CagX [Ralstonia eutropha JMP134]
MKKTLSALIVGAAVAVPSLALAAPGDDIADKYFNKTNPTLTAQERAALAIAKRWEAGSATGIKPVAGSGG
AIKFVYGAQQPSIVCAVLQVCDVALQPGEQVNSINLGDTARWTVEPAITGSGATEVQHLIIKPMDVGLET
SLVVTTNRRSYHFRLRSHRTEYMPQVSFTYPEEAQAKWDAIQRREKQERTDNTLPATGEYLGDLSFDYEL
SGSASWKPVRVYNDGRKTIIEMPGTMQQTEAPTLLVVRKEGGLFTDDETVLVNYRVQGNRYIVDTVFDRA
ILIAGVGSSQDRVTISRRK
 
Nucleotide Sequence: 900 bp     [Download]
>gi|72384244|ref|NC_007337.1|:63353-64252 Ralstonia eutropha JMP134 plasmid 1, complete sequence
ATGAAGAAAACCCTCTCCGCTTTGATCGTGGGCGCTGCTGTGGCGGTGCCCTCCCTGGCTCTGGCCGCCC
CTGGCGACGACATTGCCGACAAGTATTTCAACAAGACCAACCCGACGCTGACCGCTCAAGAGCGCGCGGC
GCTCGCCATCGCCAAACGGTGGGAAGCGGGGTCGGCGACCGGCATCAAGCCGGTGGCCGGCTCGGGCGGT
GCCATCAAGTTCGTGTACGGCGCGCAGCAGCCGAGCATCGTTTGCGCGGTGCTCCAGGTGTGCGACGTGG
CCTTGCAGCCCGGCGAACAAGTGAACTCGATCAACCTGGGCGACACGGCCAGGTGGACGGTGGAACCGGC
CATCACCGGCAGCGGCGCGACCGAGGTTCAGCACCTCATCATCAAGCCGATGGACGTGGGCCTCGAAACC
AGCCTGGTTGTGACCACGAACCGCCGCAGCTACCACTTCCGCCTGCGCTCGCATCGCACCGAGTACATGC
CGCAAGTCTCGTTCACGTACCCCGAGGAAGCGCAAGCCAAGTGGGACGCGATCCAGCGCCGCGAGAAGCA
GGAACGCACCGACAACACCCTGCCGGCGACGGGCGAGTACCTGGGCGATCTCTCGTTCGACTATGAGCTG
TCCGGGTCGGCGAGCTGGAAGCCTGTGCGCGTCTACAACGATGGCCGCAAGACCATCATCGAAATGCCCG
GCACGATGCAGCAGACCGAAGCGCCGACGCTCCTGGTCGTGCGCAAAGAGGGCGGCTTGTTCACCGACGA
CGAAACGGTGCTGGTCAATTACCGCGTGCAGGGCAATCGCTACATCGTGGACACGGTGTTTGACCGCGCG
ATCCTGATTGCCGGTGTTGGCAGTAGCCAAGACCGCGTGACCATCAGCCGGAGGAAGTGA
 Primer design