SecReT4
Protein ID: 72384310
T4SS name [ID]Trb [69]
Gene symbol-
Locus tagReut_D6508
StrainRalstonia eutropha JMP134
Repliconplasmid 1 [GenBank: NC_007337] [Browse all T4SS(s) in this replicon]
Location [Strand]64255..64743 [+]
Productconjugal transfer protein TrbH
Component typeTrbH
UniProt IDQ6UP57
KEGG IDreu:Reut_D6508
PDB IDNA
Domain hit(s) vs Pfam TrbH [PF07283], Evalue: 7.1e-49, Aligned region: 33..162
Protein Sequence: 162 a.a.     [Download]
>gi|72384310|ref|YP_293663.1| conjugal transfer TrbH [Ralstonia eutropha JMP134]
MRKIVSLALLALALGLGGCATTSQYGNFVQSAALDQQKLATDAVQQLATLYAPARTRLELQQPTPDPFGQ
ALVKSLRDKGYALLEYAPAGASTQAPASAASQASAPATTAASGGLPLRYVLDQAGDSNLYRLTLMVGNQS
ITRPYLAQNGTFAPAGYWVRKE
 
Nucleotide Sequence: 489 bp     [Download]
>gi|72384244|ref|NC_007337.1|:64255-64743 Ralstonia eutropha JMP134 plasmid 1, complete sequence
ATGCGCAAGATCGTCTCTCTCGCGCTGCTCGCCCTCGCCCTGGGCCTCGGCGGCTGCGCAACCACCAGCC
AGTACGGCAACTTCGTCCAGTCGGCCGCGCTCGATCAGCAGAAGCTCGCCACCGACGCGGTGCAGCAGCT
CGCCACGCTGTACGCGCCGGCGCGCACGCGCCTGGAGCTGCAACAGCCGACGCCCGATCCGTTCGGCCAG
GCGCTCGTCAAGTCGCTGCGCGACAAGGGCTATGCCCTCCTGGAGTACGCCCCGGCCGGCGCTTCCACGC
AGGCCCCGGCCTCGGCGGCATCGCAGGCGAGCGCACCGGCCACCACGGCCGCGTCGGGCGGCCTGCCGTT
GCGCTACGTGCTCGACCAGGCTGGCGACTCGAACCTGTACCGCCTGACCTTGATGGTCGGCAATCAATCC
ATCACCCGCCCTTACCTGGCGCAAAACGGCACGTTCGCGCCGGCCGGGTACTGGGTGCGCAAGGAGTGA
 Primer design