SecReT4
Protein ID: 72384311
T4SS name [ID]Trb [69]
Gene symbol-
Locus tagReut_D6509
StrainRalstonia eutropha JMP134
Repliconplasmid 1 [GenBank: NC_007337] [Browse all T4SS(s) in this replicon]
Location [Strand]64748..66169 [+]
Productconjugal transfer protein TrbI
Component typeTrbI
UniProt IDQ6UP56
KEGG IDreu:Reut_D6509
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 1.3e-65, Aligned region: 279..464
Protein Sequence: 473 a.a.     [Download]
>gi|72384311|ref|YP_293664.1| conjugation TrbI-like protein [Ralstonia eutropha JMP134]
MTENADQMAPDASPGEVSKKAGVRRVNNMPMYILGGVLLSFVLVMALVAADRAAKQNAPADGPKEKAGNT
SMFAKEIAGDKTGGLIEPASPLKVPDMPTGPASAPLEIARPSNPDAPPAPPANPGNPGQPVNDDEAQRIR
MAKMQMFGEAVKAKTTVRVDAPRSNGSAPGGPSTYTGTPQTRDEMLNRIAAVQQQIDAQRSNDPTAAYQA
RLAQIRGMGVGGGGAAPAAGGMGAGGAPQLLQTSTSGGGRNSMAQFGQGGQGDRWKLDSQPEAPRTPFEL
RAGFVVPATLISGINSDLPGQIMAQVAQDVYDTPTGKHLLIPQGSRLVGSYSSDVAYGQARVLVAWQRIV
FPDGKAMDIGAMPGADSAGYAGFHDQVNNHYVRLFGSAFLMSGVTAGITYSQRQNQATNTYGAPSASSAL
SEALGQQLGQVTAQLIAKNLSISPTLEIRPGYRFNVVVTKDMTFSKPYRSFDY
 
Nucleotide Sequence: 1422 bp     [Download]
>gi|72384244|ref|NC_007337.1|:64748-66169 Ralstonia eutropha JMP134 plasmid 1, complete sequence
ATGACAGAAAACGCCGATCAGATGGCACCTGACGCTTCGCCTGGCGAAGTGTCCAAGAAGGCGGGCGTCC
GTCGCGTCAACAACATGCCCATGTACATCCTCGGCGGCGTCCTGCTGTCGTTCGTGCTGGTCATGGCCCT
GGTCGCGGCGGATCGCGCGGCCAAGCAGAACGCGCCGGCGGACGGCCCCAAGGAGAAGGCCGGCAACACG
TCGATGTTCGCCAAGGAGATCGCAGGCGACAAGACCGGCGGCTTGATCGAGCCGGCAAGCCCGCTCAAGG
TGCCCGACATGCCGACCGGCCCGGCGTCGGCTCCGCTGGAGATCGCGCGGCCGTCCAACCCGGACGCGCC
GCCGGCCCCGCCGGCCAACCCCGGCAACCCGGGCCAGCCGGTGAACGACGACGAGGCCCAGCGCATCCGC
ATGGCGAAGATGCAGATGTTCGGCGAAGCCGTGAAGGCCAAGACCACCGTGCGCGTGGATGCCCCGCGTA
GCAACGGCTCCGCGCCGGGTGGCCCGAGCACCTACACCGGCACGCCGCAGACGCGCGATGAAATGCTGAA
CCGCATCGCAGCGGTGCAGCAGCAAATCGACGCGCAGCGCAGCAACGATCCGACCGCCGCCTATCAAGCA
CGCCTGGCGCAGATTCGCGGCATGGGCGTCGGTGGTGGCGGCGCGGCTCCGGCCGCCGGCGGCATGGGCG
CGGGCGGTGCGCCGCAGCTCCTGCAAACCTCGACCAGCGGCGGCGGGCGCAACAGCATGGCGCAGTTCGG
CCAAGGTGGGCAGGGCGACCGCTGGAAGCTGGATTCGCAGCCGGAAGCGCCGCGCACACCGTTCGAGCTG
CGCGCGGGCTTCGTCGTGCCGGCCACGCTCATTTCGGGCATCAACTCCGATCTGCCGGGCCAAATCATGG
CCCAGGTCGCGCAGGACGTGTACGACACACCGACCGGCAAGCACCTGTTGATCCCGCAGGGATCGCGCCT
CGTCGGCTCGTATTCGAGCGACGTGGCCTACGGCCAAGCGCGCGTGCTGGTTGCGTGGCAACGCATCGTG
TTCCCCGATGGCAAGGCGATGGACATTGGCGCGATGCCAGGCGCGGACAGCGCGGGATACGCGGGCTTCC
ACGACCAGGTGAACAACCACTATGTGCGCCTGTTCGGCTCGGCCTTCCTCATGTCCGGCGTGACAGCAGG
CATCACCTACAGCCAACGCCAGAACCAGGCCACAAACACCTATGGCGCACCGAGCGCCAGCAGTGCCCTA
AGCGAAGCCCTCGGCCAGCAGCTCGGCCAGGTTACGGCGCAACTCATCGCCAAGAACCTGAGCATTTCGC
CGACGCTGGAAATTCGGCCGGGGTATCGCTTCAACGTCGTGGTCACGAAGGACATGACGTTTTCCAAGCC
GTACCGTTCCTTCGATTACTAA
 Primer design