SecReT4
Protein ID: 72384312
T4SS name [ID]Trb [69]
Gene symbol-
Locus tagReut_D6510
StrainRalstonia eutropha JMP134
Repliconplasmid 1 [GenBank: NC_007337] [Browse all T4SS(s) in this replicon]
Location [Strand]66190..66954 [+]
Productconjugal transfer protein TrbJ
Component typeTrbJ
UniProt IDQ6UP55
KEGG IDreu:Reut_D6510
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 254 a.a.     [Download]
>gi|72384312|ref|YP_293665.1| TrbJ protein of DNA transfer system [Ralstonia eutropha JMP134]
MKPKFLAAKLALVIAVSSTLAVTPVQAGIPVIDGTNLSQNIMTAIESVAQTLKQIEQYSTQLQQYQNQLQ
NTMAPAAYIWDQAQSTINGLMNAVNTLDYYKTQLGSLDSYIGKFQDVNYYKNSPCFTAAGCSDAERAALR
NVAQLASESQKKANDALFKGLDRQQTNLTADAATLQRLQSAAQGAQGQMQAIGYANQLASQQANQLLQIR
GLLIAQQNAMATKMQADADKEAQQAAAAAQLRQGSYRASPARTW
 
Nucleotide Sequence: 765 bp     [Download]
>gi|72384244|ref|NC_007337.1|:66190-66954 Ralstonia eutropha JMP134 plasmid 1, complete sequence
ATGAAGCCGAAGTTTTTAGCCGCTAAATTGGCCCTCGTCATTGCTGTTTCGAGCACGCTGGCGGTCACAC
CTGTGCAGGCTGGCATCCCCGTCATCGACGGCACCAACCTGTCGCAGAACATCATGACGGCCATCGAATC
GGTGGCCCAGACGCTCAAGCAAATTGAGCAGTACAGCACCCAGCTCCAGCAGTATCAAAACCAACTCCAG
AACACGATGGCCCCGGCCGCGTATATCTGGGATCAGGCGCAATCGACCATCAACGGGTTGATGAACGCGG
TCAACACGCTGGATTACTACAAGACCCAACTCGGCAGCCTGGACAGCTACATCGGCAAGTTCCAGGACGT
GAACTACTACAAGAACTCGCCGTGCTTTACGGCGGCAGGGTGCTCCGACGCGGAACGCGCAGCACTTCGG
AATGTGGCCCAGCTCGCGAGCGAGTCGCAGAAGAAGGCCAACGATGCCTTGTTCAAGGGCCTCGATAGGC
AGCAAACGAATCTCACGGCCGATGCAGCGACGTTGCAGCGTCTTCAATCGGCAGCGCAGGGCGCGCAGGG
CCAAATGCAGGCCATCGGCTACGCCAACCAGCTCGCCAGCCAGCAGGCCAACCAGCTCTTGCAGATTCGT
GGCCTGCTGATCGCGCAGCAGAACGCGATGGCAACCAAGATGCAGGCCGACGCCGACAAGGAAGCCCAGC
AGGCGGCAGCGGCCGCACAACTGCGCCAGGGCAGCTACCGGGCCAGCCCGGCGCGCACCTGGTAA
 Primer design