SecReT4
Protein ID: 72384313
T4SS name [ID]Trb [69]
Gene symbol-
Locus tagReut_D6511
StrainRalstonia eutropha JMP134
Repliconplasmid 1 [GenBank: NC_007337] [Browse all T4SS(s) in this replicon]
Location [Strand]66964..67191 [+]
Productentry exclusion protein TrbK
Component typeTrbK
UniProt IDQ6UP54
KEGG IDreu:Reut_D6511
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 75 a.a.     [Download]
>gi|72384313|ref|YP_293666.1| entry exclusion protein TrbK [Ralstonia eutropha JMP134]
MKAIKALSLASAALVAALVAGCDNKPATAPMPEVNDENCKPENIAKIEDKGVQQAFSSLCLRRGGDFKPS
PKREW
 
Nucleotide Sequence: 228 bp     [Download]
>gi|72384244|ref|NC_007337.1|:66964-67191 Ralstonia eutropha JMP134 plasmid 1, complete sequence
ATGAAAGCAATCAAGGCTCTGTCCTTGGCCTCGGCCGCCCTCGTGGCGGCCTTGGTCGCCGGCTGCGACA
ACAAGCCGGCCACGGCCCCCATGCCGGAAGTGAACGACGAGAACTGCAAGCCCGAGAACATCGCCAAGAT
CGAGGACAAGGGCGTCCAGCAGGCTTTTTCGTCGCTGTGCTTGCGTCGTGGTGGGGATTTCAAGCCCAGC
CCGAAACGCGAATGGTGA
 Primer design