SecReT4
Protein ID: 72384314
T4SS name [ID]Trb [69]
Gene symbol-
Locus tagReut_D6512
StrainRalstonia eutropha JMP134
Repliconplasmid 1 [GenBank: NC_007337] [Browse all T4SS(s) in this replicon]
Location [Strand]67202..68920 [+]
ProductTrbL/VirB6 plasmid conjugal transfer protein
Component typeTrbL
UniProt IDQ6UP53
KEGG IDreu:Reut_D6512
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1.6e-38, Aligned region: 65..279
Protein Sequence: 572 a.a.     [Download]
>gi|72384314|ref|YP_293667.1| TrbL/VirB6 plasmid conjugal transfer protein [Ralstonia eutropha JMP134]
MRMPANLKTLALPLFVWLAFFAVDAHAAIDNAGVFDSVLDRYQAAASGWAGVITTAATWLFWTLVVISMV
WTFGMMALRKADIGEFFAEFVRFTIFTGFFWWALTNGPNFASSIYASLRQLAGNATGLGNALSPSGIVDV
GFAIFDKVMDQSSVWSPVDSMAGILMAVAILVILALVGVNMLLLLASGWVLAYGGVFFLGFGGSRWTSDM
AINYYKVVLGVAAQLFAMVLLVGIGKTFLDDYYSRMSAGISLKEMGVMLIVVIILLALVNKIPPLIAGII
TGASVGGAGIGQFGAGAALGAAGMAAAAAATGGAALAAGAASAAGGASAVMAAFSKANENVSAGTDVMSA
FSGGGSSGGGAGGGGDAGTGSTPFAQAAGFSGSSGGGSSSGGGSPSTGSSSGSSKGGDKGGGKADAGGQG
SSSTASTGSSADKAAKNEPKPAGGAGQGQQAAPGSTGPGLLASAASALGTAGRIAADAGANLAKGTADVA
KAKAASLREAAAERIADTTGGKIAAAIKAQGSGTAENIDVPDQQPAPSFGDNSLAGGPADADPESEVAAF
ANREQGRDGTTA
 
Nucleotide Sequence: 1719 bp     [Download]
>gi|72384244|ref|NC_007337.1|:67202-68920 Ralstonia eutropha JMP134 plasmid 1, complete sequence
ATGAGAATGCCAGCCAATCTAAAAACCCTCGCCCTGCCGCTGTTCGTCTGGCTGGCGTTCTTCGCGGTCG
ATGCCCACGCGGCCATCGACAACGCCGGCGTGTTCGATAGCGTGCTGGATCGCTACCAGGCCGCCGCGAG
CGGCTGGGCCGGTGTCATCACCACGGCCGCAACCTGGCTCTTCTGGACGCTGGTTGTGATCTCGATGGTC
TGGACGTTCGGCATGATGGCCTTGCGCAAGGCCGACATTGGCGAGTTCTTCGCGGAGTTCGTCCGCTTCA
CGATCTTTACCGGCTTCTTCTGGTGGGCGCTAACCAACGGCCCTAACTTCGCCTCGTCCATCTATGCGTC
GTTGCGGCAGCTCGCCGGCAACGCGACGGGCCTGGGCAATGCTCTGTCGCCCTCGGGCATCGTGGACGTG
GGCTTTGCGATCTTCGACAAGGTGATGGATCAGTCCTCGGTGTGGTCGCCGGTGGACAGCATGGCCGGCA
TCCTCATGGCCGTGGCGATCCTGGTCATCCTGGCCCTGGTCGGTGTGAATATGCTTCTGCTGCTCGCGTC
GGGCTGGGTGCTCGCCTACGGCGGCGTGTTCTTCCTCGGCTTCGGTGGTTCGCGCTGGACTTCCGACATG
GCGATCAACTACTACAAGGTCGTCCTGGGCGTGGCCGCGCAGCTCTTCGCAATGGTGCTCCTGGTGGGCA
TCGGCAAGACCTTCCTCGATGACTACTACTCGCGCATGAGCGCCGGCATCAGCCTCAAGGAAATGGGCGT
GATGCTGATCGTCGTCATCATCCTCTTGGCGTTGGTCAACAAGATTCCGCCGCTCATCGCCGGGATCATC
ACCGGCGCGAGCGTGGGCGGTGCCGGCATCGGCCAGTTCGGTGCAGGTGCTGCGTTGGGTGCCGCAGGCA
TGGCAGCAGCAGCGGCCGCGACCGGCGGCGCCGCTCTGGCCGCCGGCGCAGCCTCGGCCGCCGGTGGTGC
CTCTGCCGTCATGGCCGCCTTCTCGAAGGCCAATGAGAACGTGTCGGCAGGCACGGACGTTATGTCGGCC
TTCTCGGGCGGCGGCAGCTCGGGCGGCGGTGCGGGCGGCGGCGGCGACGCCGGCACCGGCAGCACGCCCT
TCGCTCAGGCTGCGGGCTTTAGCGGCAGCTCCGGCGGTGGCTCTTCGTCGGGTGGCGGCAGCCCCTCGAC
CGGCAGCAGCTCGGGCAGCTCGAAGGGCGGCGATAAGGGCGGCGGCAAAGCCGACGCCGGCGGCCAGGGC
AGCAGCTCGACGGCCAGCACCGGCAGCAGTGCCGACAAGGCCGCCAAGAACGAACCCAAGCCCGCCGGCG
GGGCAGGGCAAGGGCAGCAGGCCGCACCGGGCAGCACCGGCCCCGGCTTGCTCGCATCGGCCGCATCGGC
CCTCGGCACGGCCGGCCGCATCGCCGCCGACGCCGGCGCGAACTTGGCGAAGGGAACCGCCGATGTTGCC
AAGGCCAAAGCCGCGAGCCTGCGCGAAGCCGCAGCCGAGCGGATCGCCGACACCACTGGCGGAAAGATCG
CCGCCGCGATCAAGGCGCAAGGAAGCGGCACGGCCGAGAACATCGACGTGCCCGACCAGCAGCCCGCGCC
GAGCTTCGGCGACAACAGCCTGGCAGGCGGCCCTGCCGATGCCGATCCCGAGTCCGAAGTAGCTGCGTTC
GCCAACCGCGAGCAAGGCCGCGACGGCACAACTGCGTAA
 Primer design