SecReT4
Protein ID: 72384316
T4SS name [ID]Trb [69]
Gene symbol-
Locus tagReut_D6514
StrainRalstonia eutropha JMP134
Repliconplasmid 1 [GenBank: NC_007337] [Browse all T4SS(s) in this replicon]
Location [Strand]69539..70174 [+]
Productconjugal transfer protein TrbN
Component typeTrbN
UniProt IDQ6UP51
KEGG IDreu:Reut_D6514
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 211 a.a.     [Download]
>gi|72384316|ref|YP_293669.1| lytic transglycosylase, catalytic [Ralstonia eutropha JMP134]
MPFFADLPPQLQERVVCSISAAVKYEVPVNIVLAVAEKEGGKPGQWVRNSNGTHDVGPMQFNTAYLGDLA
RYGITANDVAAAGCYSFDLAAWRLRMHIRNDKGDLWTKAANYHSRTPQYNAVYRADLMRKASKWADWLEA
RFVTLDVTKAGATPSTPSQPATVAQRATPAARPAPAPQQAAPAAAAARSVSVAGYVPRTVSFNTSREGSA
E
 
Nucleotide Sequence: 636 bp     [Download]
>gi|72384244|ref|NC_007337.1|:69539-70174 Ralstonia eutropha JMP134 plasmid 1, complete sequence
ATGCCGTTCTTCGCCGATCTGCCGCCGCAGCTCCAGGAGCGCGTCGTCTGCTCGATCTCGGCCGCCGTCA
AGTACGAGGTGCCGGTCAACATCGTGTTGGCCGTCGCCGAGAAAGAGGGCGGCAAGCCGGGCCAGTGGGT
GCGCAACTCGAATGGCACGCATGACGTTGGCCCGATGCAGTTCAACACCGCGTACCTGGGCGACCTGGCC
CGATACGGCATCACGGCGAACGATGTGGCGGCTGCCGGCTGCTACTCGTTCGACCTGGCCGCCTGGCGGC
TGCGGATGCACATCCGCAACGACAAGGGCGACCTCTGGACGAAGGCGGCGAACTACCACTCGCGCACGCC
GCAGTACAACGCGGTGTACCGGGCCGACTTGATGCGCAAGGCGTCGAAGTGGGCCGATTGGCTCGAAGCT
CGGTTCGTCACGCTTGACGTGACGAAGGCCGGGGCCACGCCCTCGACGCCCAGCCAGCCCGCGACGGTGG
CCCAGCGGGCGACGCCGGCGGCCAGGCCGGCACCAGCACCCCAGCAGGCCGCCCCAGCGGCCGCAGCAGC
TCGCAGCGTGTCGGTGGCCGGCTACGTGCCCCGCACGGTGTCTTTCAACACTTCACGCGAGGGGTCGGCC
GAGTAG
 Primer design