SecReT4
Protein ID: 72384326
T4SS name [ID]Trb [69]
Gene symbol-
Locus tagReut_D6524
StrainRalstonia eutropha JMP134
Repliconplasmid 1 [GenBank: NC_007337] [Browse all T4SS(s) in this replicon]
Location [Strand]80621..81157 [-]
Productconjugal transfer peptidase TraF
Component typeTraF
UniProt IDQ6UP40
KEGG IDreu:Reut_D6524
PDB IDNA
Domain hit(s) vs Pfam Peptidase_S26 [PF10502], Evalue: 1.7e-45, Aligned region: 32..177
Protein Sequence: 178 a.a.     [Download]
>gi|72384326|ref|YP_293679.1| TraF peptidase [Ralstonia eutropha JMP134]
MSRILKRIAAGVVIAGVAALLLAAGGYAAGARVNTTKSIPVGLYWTSSAPVEKGAYVLFCPPQLGVFDDA
KERGYIGAGFCQGGYGYMMKRVLAAKDDAVAVADDGVRVNGELLPLSAPIKADKAGRPLPRYQSNSYTLG
NSEVLLMSDVSATSFDGRYFGPINRSQIKTVIRPVITW
 
Nucleotide Sequence: 537 bp     [Download]
>gi|72384244|ref|NC_007337.1|:c81157-80621 Ralstonia eutropha JMP134 plasmid 1, complete sequence
ATGAGCCGCATCCTGAAACGCATCGCGGCAGGCGTCGTCATCGCGGGCGTGGCCGCCCTGCTGCTGGCCG
CCGGCGGCTATGCCGCCGGTGCCCGCGTGAACACCACCAAGAGCATTCCGGTCGGCCTGTACTGGACGAG
CAGCGCGCCGGTGGAGAAGGGGGCCTACGTCCTCTTCTGCCCGCCGCAGCTCGGCGTGTTCGATGACGCC
AAGGAGAGGGGCTACATCGGGGCCGGCTTCTGCCAGGGCGGCTACGGCTACATGATGAAGCGCGTTTTAG
CCGCTAAAGACGATGCCGTCGCCGTCGCCGATGACGGCGTGCGCGTCAACGGCGAGCTGCTGCCCCTCAG
CGCGCCGATCAAGGCCGACAAGGCCGGTCGGCCGCTGCCGCGCTATCAGTCCAACAGCTACACGCTCGGC
AATTCCGAGGTGCTGCTTATGTCGGACGTGAGCGCCACATCCTTCGACGGCCGCTACTTCGGCCCGATCA
ATCGTTCGCAAATCAAGACCGTGATCCGTCCGGTCATCACCTGGTAG
 Primer design