SecReT4
Protein ID: 72384327
T4SS name [ID]Trb [69]
Gene symbol-
Locus tagReut_D6525
StrainRalstonia eutropha JMP134
Repliconplasmid 1 [GenBank: NC_007337] [Browse all T4SS(s) in this replicon]
Location [Strand]81154..83067 [-]
Productconjugal transfer coupling protein TraG
Component typeTraG
UniProt IDQ6UP39
KEGG IDreu:Reut_D6525
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 1.8e-162, Aligned region: 121..620
TraG-D_C [PF12696], Evalue: 1.9e-32, Aligned region: 444..568
TrwB_AAD_bind [PF10412], Evalue: 1.5e-26, Aligned region: 177..568
Protein Sequence: 637 a.a.     [Download]
>gi|72384327|ref|YP_293680.1| TRAG protein [Ralstonia eutropha JMP134]
MKIKMNNAVGPQVRTAKPKPSKLLPVLGAASMVGGLQAATQFFAHTFAYHATLGPNVGHVYAPWSILHWT
YKWYSQYPDEIMKAGSMGMLVSTVGLLGVAVAKVVTSNSSKANEYLHGSARWAEKKDIQAAGLLPRERNV
LEIVTGKAAPTATGVYVGGWQDKDGNFFYLRHSGPEHVLTYAPTRSGKGVGLVVPTLLSWGASSVITDLK
GELWALTAGWRQKHAKNKVLRFEPASTSGGVCWNPLDEIRLGTEYEVGDVQNLATLIVDPDGKGLDSHWQ
KTAFALLVGVILHALYKAKDDGGTATLPSVDAMLADPNRDIGELWMEMATYGHVDGQNHHAIGSAARDMM
DRPEEEAGSVLSTAKSYLALYRDPVVARNVSRSDFRIKQLMHEDDPVSLYIVTQPNDKARLRPLVRVMVN
MIVRLLADKMDFEGGRPVAHYKHRLLMMLDEFPSLGKLEIMQESLAFVAGYGIKCYLICQDINQLKSRET
GYGHDESITSNCHVQNAYPPNRVETAEHLSRLTGQTTVVKEQITTSGRRTAAMLGQVSRTYQEVQRPLLT
PDECLRMPGPKKNAQGEIEEAGDMVIYVAGYPAIYGKQPLYFKDPVFSARAAIPAPKVSDRLRAVAQAET
EGEGITI
 
Nucleotide Sequence: 1914 bp     [Download]
>gi|72384244|ref|NC_007337.1|:c83067-81154 Ralstonia eutropha JMP134 plasmid 1, complete sequence
ATGAAGATCAAGATGAACAACGCGGTAGGGCCGCAAGTCCGAACCGCCAAACCGAAGCCGAGCAAGCTGC
TGCCGGTGCTGGGCGCGGCCTCGATGGTCGGCGGCCTCCAGGCCGCGACGCAGTTCTTCGCCCACACGTT
CGCCTATCACGCGACCCTCGGCCCCAACGTGGGCCACGTGTACGCGCCCTGGTCGATCCTGCACTGGACG
TACAAGTGGTACAGCCAGTACCCGGACGAGATCATGAAGGCCGGCAGCATGGGGATGCTGGTTTCGACCG
TGGGCCTGCTGGGCGTGGCCGTGGCGAAGGTCGTCACGTCCAACAGCTCGAAGGCGAACGAGTACCTGCA
CGGCTCGGCCCGCTGGGCCGAGAAGAAGGACATTCAGGCGGCCGGCCTGCTGCCACGCGAGCGCAACGTC
CTGGAGATCGTCACCGGCAAGGCCGCACCCACGGCTACCGGCGTGTACGTGGGCGGCTGGCAGGACAAGG
ACGGCAATTTCTTCTACCTGCGGCACAGCGGCCCCGAGCACGTGCTGACCTACGCGCCCACGCGCTCGGG
CAAGGGCGTCGGCCTGGTGGTGCCCACGCTGCTGTCGTGGGGCGCGAGCAGCGTCATCACCGACTTGAAG
GGCGAGTTGTGGGCCTTGACCGCCGGCTGGCGGCAGAAGCACGCCAAGAACAAGGTGCTGCGCTTCGAGC
CGGCCAGCACCTCGGGCGGCGTCTGCTGGAATCCGCTGGACGAAATCCGCCTCGGCACCGAATACGAGGT
GGGTGACGTGCAGAACCTTGCCACGCTGATCGTTGACCCGGACGGCAAGGGCCTGGACTCGCACTGGCAG
AAGACCGCCTTCGCGCTCCTGGTCGGCGTGATCCTGCACGCGCTGTACAAGGCCAAGGACGATGGCGGCA
CCGCCACGCTGCCGTCCGTCGATGCGATGCTGGCCGACCCGAACCGGGACATTGGCGAGCTTTGGATGGA
AATGGCGACCTACGGGCACGTAGACGGCCAGAACCATCACGCCATCGGCTCGGCGGCCCGCGACATGATG
GATCGGCCCGAGGAAGAAGCCGGATCGGTGCTGTCCACGGCCAAGTCGTACCTGGCCCTGTACCGCGACC
CCGTGGTGGCCCGCAACGTCAGCCGGTCGGACTTCCGCATCAAGCAGTTGATGCACGAGGACGACCCGGT
AAGCCTCTACATTGTCACCCAGCCCAACGATAAGGCCCGCCTGCGGCCGCTGGTGCGCGTCATGGTGAAC
ATGATCGTGCGCCTGCTGGCCGACAAGATGGACTTCGAGGGCGGCCGGCCGGTGGCGCACTACAAGCACC
GGCTCTTGATGATGCTGGACGAGTTCCCGAGCCTCGGGAAGCTGGAGATCATGCAAGAGTCGCTGGCCTT
CGTGGCCGGCTACGGCATCAAGTGCTACCTCATCTGCCAGGACATTAACCAGCTCAAGAGCCGCGAGACG
GGCTACGGCCACGACGAAAGCATCACGTCGAACTGCCACGTGCAGAACGCCTACCCGCCCAACCGCGTCG
AGACGGCCGAACACCTGTCCCGCCTCACCGGGCAGACCACCGTGGTGAAGGAGCAGATCACGACCAGCGG
CCGCCGCACGGCGGCGATGCTGGGCCAGGTGTCGCGCACTTACCAGGAAGTGCAGCGGCCCTTGCTGACG
CCCGACGAATGCCTGCGCATGCCGGGGCCAAAGAAGAACGCCCAGGGCGAGATCGAAGAAGCCGGCGACA
TGGTGATCTACGTCGCGGGCTACCCGGCGATCTACGGCAAGCAACCCCTGTACTTCAAAGACCCAGTGTT
CTCGGCACGCGCCGCGATCCCTGCGCCCAAGGTCAGCGACCGCCTGCGCGCCGTCGCACAGGCCGAGACG
GAAGGGGAGGGCATCACGATATGA
 Primer design