SecReT4
Protein ID: 73666651
T4SS name [ID]VirB [502]
Gene symbol-
Locus tagEcaj_0018
StrainEhrlichia canis str. Jake
Repliconchromosome [GenBank: NC_007354] [Browse all T4SS(s) in this replicon]
Location [Strand]19831..22002 [-]
Producttype IV secretion system protein VirB8
Component typeVirD4
UniProt IDQ3YT86
KEGG IDecn:Ecaj_0018
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 5.4e-152, Aligned region: 125..569
TraG-D_C [PF12696], Evalue: 9.5e-27, Aligned region: 408..530
TrwB_AAD_bind [PF10412], Evalue: 4.3e-26, Aligned region: 241..544
Protein Sequence: 723 a.a.     [Download]
>gi|73666651|ref|YP_302667.1| type IV secretion system protein VirB8 [Ehrlichia canis str. Jake]
MDSISANHIRNILFLVLGAFFGLEFCFYLSGVLFILMVWGPNYLDFNAINPSLSDFPDRIWPTIFDYVQH
WWKNPSAYDAVLLLKLITSLCTPVGILSIVLWNLRNILFDWRPFKKKESLHGDSRWATEKDIRKIGLRSR
KGILLGKDKRGYLIADGYQHALLFAPTGSGKGVGFVIPNLLFWEDSVVVHDIKLENYDLTSGWRKKRGQE
VFVWNPAQPDGISHCYNPLDWISSKPGQMVDDVQKIANLIMPEQDFWYNEARSLFVGVVLYLLAVPEKVK
SFGEVVRTMRSDDVVYNLAVVLDTIGKKIHPVAYMNIAAFLQKADKERSGVVSTMNSSLELWANPLIDTA
TASSDFNIQEFKRKKVTVYVGLTPDNLTRLRPLMQVFYQQATEFLCRTLPSDDEPYGVLFLMDEFPTLGK
MEQFQTGIAYFRGYRVRLFLIIQDTEQLKGIYEEAGMNSFLSNSTYRITFAANNIETANLISQLIGNKTV
NQESLNRPKFLDLNPASRSLHISETQRALLLPQEVIMLPRDEQILLIESTYPIKSKKIKYYEDKNFTKKL
LKSTFVPTQEPYDPNKTKTATKENEEPMPSIESDLPKNTSDNTENNMEDGAMYSSIEEDYDDDDDDFNFE
DLDEYMDEEEDYDDEEYDDIDYDDNNNSNEEYEEDNPEEDDNSNNLDDEEEEEDNIIDYEDEEEYDDNID
YKDDDNNYNKDTTDDQDSKKHNE
 
Nucleotide Sequence: 2172 bp     [Download]
>gi|73666633|ref|NC_007354.1|:c22002-19831 Ehrlichia canis str. Jake chromosome, complete genome
ATGGATAGTATAAGTGCAAATCACATACGCAATATTTTATTCCTTGTTTTAGGCGCATTTTTTGGACTGG
AATTTTGCTTTTATTTATCAGGTGTATTATTCATCTTAATGGTCTGGGGACCAAATTACCTAGATTTTAA
TGCTATAAATCCCAGTTTGAGTGATTTTCCAGACAGAATTTGGCCAACTATTTTTGACTATGTACAACAT
TGGTGGAAGAACCCTTCTGCATACGATGCAGTTTTATTACTTAAGCTAATAACGTCATTATGTACACCAG
TAGGTATTCTAAGCATAGTATTATGGAACCTTAGAAATATATTATTCGATTGGAGGCCATTTAAGAAGAA
AGAATCACTGCATGGAGATTCAAGATGGGCAACAGAAAAAGATATTCGCAAAATAGGATTACGTAGTAGA
AAAGGAATATTATTAGGGAAAGACAAGAGAGGATATCTCATTGCAGATGGATATCAACATGCATTGTTAT
TTGCACCAACTGGATCCGGAAAAGGTGTAGGTTTTGTAATACCAAACTTATTATTCTGGGAAGATTCTGT
AGTAGTACACGATATAAAATTAGAGAACTATGATCTTACAAGTGGGTGGAGAAAAAAAAGGGGACAAGAA
GTTTTCGTGTGGAACCCAGCACAACCTGACGGTATAAGTCACTGTTACAACCCATTAGATTGGATAAGCT
CTAAGCCTGGACAAATGGTAGATGATGTACAAAAAATTGCCAATCTAATAATGCCTGAACAAGATTTTTG
GTATAACGAAGCACGTAGTTTATTTGTAGGAGTAGTATTATACTTACTAGCAGTACCAGAAAAAGTAAAA
TCCTTTGGAGAAGTTGTAAGAACAATGCGCAGCGATGACGTAGTCTACAACTTAGCAGTAGTACTAGACA
CAATAGGGAAAAAGATTCACCCAGTTGCATACATGAATATAGCTGCATTTTTACAAAAAGCAGACAAAGA
ACGCTCAGGTGTTGTATCAACTATGAACTCATCTTTAGAATTATGGGCAAACCCATTAATAGATACAGCA
ACAGCATCAAGTGATTTTAATATTCAAGAATTTAAAAGGAAAAAAGTAACAGTATATGTTGGATTAACAC
CAGATAATTTAACTCGTCTTAGACCTTTAATGCAGGTATTTTATCAACAAGCTACAGAATTTTTATGTAG
AACTTTACCATCAGATGATGAACCATATGGTGTACTGTTCTTAATGGATGAGTTTCCAACATTAGGAAAA
ATGGAGCAATTTCAAACAGGTATCGCATATTTCCGTGGATATAGAGTTAGACTATTTTTGATTATTCAAG
ATACTGAACAGCTTAAGGGTATATATGAAGAAGCAGGAATGAACTCATTCTTATCAAACTCTACTTATAG
AATAACTTTTGCTGCAAATAATATAGAAACTGCAAATTTAATATCACAGTTAATAGGAAATAAAACTGTT
AACCAAGAGTCTTTAAACAGACCTAAATTTTTAGATTTGAACCCTGCATCACGTTCATTACATATATCAG
AAACACAAAGAGCTTTACTATTACCTCAAGAAGTAATAATGTTACCCAGAGATGAGCAAATACTTTTAAT
AGAATCTACTTATCCTATAAAATCAAAGAAAATAAAATACTATGAAGACAAAAATTTTACAAAAAAACTA
TTAAAGAGTACCTTTGTTCCAACTCAAGAGCCTTATGATCCCAACAAAACAAAAACAGCAACAAAAGAAA
ACGAAGAACCTATGCCAAGTATTGAAAGCGATCTTCCTAAAAATACATCTGACAATACTGAAAACAATAT
GGAAGATGGTGCAATGTACAGCAGCATAGAAGAAGATTATGACGATGATGATGATGATTTTAATTTTGAA
GACTTAGATGAATATATGGATGAAGAAGAAGATTATGATGATGAAGAATATGATGATATAGATTATGATG
ATAATAACAATAGTAATGAGGAGTATGAAGAAGATAATCCAGAAGAAGATGACAATAGCAATAATCTAGA
CGATGAGGAAGAGGAAGAAGATAATATTATAGATTATGAAGATGAAGAAGAATATGATGATAACATAGAC
TACAAAGATGATGACAATAACTACAACAAAGATACCACTGACGATCAAGACTCAAAAAAACATAATGAAT
AG
 Primer design