SecReT4
Protein ID: 73666652
T4SS name [ID]VirB [502]
Gene symbol-
Locus tagEcaj_0019
StrainEhrlichia canis str. Jake
Repliconchromosome [GenBank: NC_007354] [Browse all T4SS(s) in this replicon]
Location [Strand]22041..23039 [-]
Producttype IV secretion system ATPase VirB11
Component typeVirB11
UniProt IDQ3YT85
KEGG IDecn:Ecaj_0019
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 2e-89, Aligned region: 12..312
Protein Sequence: 332 a.a.     [Download]
>gi|73666652|ref|YP_302668.1| type IV secretion system ATPase VirB11 [Ehrlichia canis str. Jake]
MTTSYAALDTYLEPLQSIFNEDGVNEVSINQACEVWVENRGNIRCESIPILNLSHLKALGRLIAQATEQK
ISEENPLLSATLPNGYRIQIVFPPACEATAVAMSIRKPSAMQLSLDDYEKMGAFDQAITETKENSIDNEL
NELLKQKKIKQFLECAVINKKNIIISGGTSTGKTTFTNAALRSIPKDERLITVEDAREIVLSNHPNRVHL
ISSKGGQGRAKVTTQDLIEACLRLRPDRIIVGELRGAEAFSFLRAINTGHPGSISTLHADTPMMALEQLK
LMVMQAGLGIPPDQIINYITNIVDIVIQLKRASGGVRYVSEILFTKSLQKNS
 
Nucleotide Sequence: 999 bp     [Download]
>gi|73666633|ref|NC_007354.1|:c23039-22041 Ehrlichia canis str. Jake chromosome, complete genome
ATGACAACAAGTTATGCAGCTTTAGATACGTATCTTGAACCATTGCAGTCTATTTTTAACGAAGATGGAG
TAAACGAAGTATCTATAAATCAAGCATGTGAAGTATGGGTAGAAAATAGAGGGAACATACGATGTGAATC
CATTCCAATTCTTAATTTGTCACACTTAAAAGCACTAGGAAGGTTAATAGCACAAGCTACAGAACAGAAG
ATAAGTGAAGAAAATCCATTACTATCTGCAACTTTACCTAATGGTTATCGTATACAAATTGTCTTCCCAC
CAGCTTGTGAAGCAACTGCAGTAGCTATGTCAATCAGAAAGCCATCAGCTATGCAGCTTTCATTGGATGA
CTATGAAAAAATGGGAGCATTTGATCAGGCTATTACAGAAACCAAAGAAAACTCCATAGATAATGAATTA
AATGAATTATTAAAACAAAAAAAAATTAAACAATTTCTAGAATGTGCAGTAATAAACAAAAAAAACATAA
TAATAAGCGGTGGTACATCAACAGGAAAAACAACTTTCACTAACGCAGCACTACGAAGTATACCCAAAGA
TGAAAGGCTAATTACAGTAGAAGATGCAAGAGAAATTGTACTAAGTAACCATCCAAACAGAGTACATCTA
ATTTCATCAAAAGGAGGACAAGGTAGAGCTAAAGTTACCACTCAAGACTTAATAGAAGCATGTTTGAGAT
TACGTCCAGATAGAATAATAGTAGGAGAATTACGTGGAGCTGAAGCATTTAGCTTTTTAAGAGCAATCAA
TACAGGTCATCCTGGATCTATATCTACTTTACATGCAGACACACCGATGATGGCATTGGAACAATTAAAA
TTAATGGTTATGCAAGCAGGACTTGGTATACCGCCAGATCAAATCATAAATTATATTACTAATATAGTAG
ACATTGTAATACAATTAAAAAGAGCATCAGGTGGTGTAAGATATGTGTCAGAAATACTATTCACTAAATC
TTTACAGAAAAATAGTTAA
 Primer design