SecReT4
Protein ID: 73666655
T4SS name [ID]VirB [502]
Gene symbol-
Locus tagEcaj_0022
StrainEhrlichia canis str. Jake
Repliconchromosome [GenBank: NC_007354] [Browse all T4SS(s) in this replicon]
Location [Strand]25226..25930 [-]
Productvirulence protein
Component typeVirB8
UniProt IDQ3YT82
KEGG IDecn:Ecaj_0022
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.1e-50, Aligned region: 27..232
Protein Sequence: 234 a.a.     [Download]
>gi|73666655|ref|YP_302671.1| virulence protein [Ehrlichia canis str. Jake]
MFNKFKKKNNTSDNKKPLKANLETTYSWHVSRYNSVVIQRNMLLFFTVLALSAVGISVFVISNISKSRTI
EPFVVEIEKKSGITTLVNPVSVKQYSADEVLNNYFIIEYVRSRELFDPNNFQYNYYTKVRLFSNQTTYSE
FRNWIRLSNPASPLNLYANVTSGYLKIRSLQHLRPGNVQIRFSLEFNHPNGTIKRDRIATLSFQYVTLEM
NEQERQINPLGFQITYYRADDEFL
 
Nucleotide Sequence: 705 bp     [Download]
>gi|73666633|ref|NC_007354.1|:c25930-25226 Ehrlichia canis str. Jake chromosome, complete genome
ATGTTTAATAAATTTAAAAAAAAGAACAACACAAGTGATAATAAAAAACCATTAAAGGCAAATTTAGAAA
CAACATATAGTTGGCATGTCAGTCGGTATAATTCAGTTGTCATACAAAGGAACATGCTACTGTTTTTCAC
AGTGCTGGCACTAAGTGCAGTAGGAATTAGTGTTTTTGTCATCTCTAATATAAGCAAAAGCAGGACTATT
GAGCCATTTGTAGTAGAAATAGAAAAGAAATCAGGAATTACAACATTAGTAAATCCTGTATCAGTTAAAC
AATATTCAGCAGATGAAGTTTTGAATAATTACTTCATAATAGAATATGTAAGATCTAGAGAACTTTTTGA
CCCTAATAATTTCCAATATAATTACTATACAAAAGTTCGTCTATTTTCCAACCAAACAACATATAGTGAA
TTTCGTAACTGGATAAGGTTAAGCAATCCTGCAAGTCCTTTGAACTTATATGCAAATGTAACATCAGGAT
ATCTAAAAATTAGATCTTTACAGCACTTGCGTCCAGGAAATGTGCAAATAAGATTTTCTTTAGAATTCAA
CCATCCAAATGGTACAATAAAAAGAGACAGAATAGCTACATTATCATTTCAATACGTAACTCTTGAAATG
AATGAACAAGAAAGACAAATTAATCCTTTAGGATTTCAAATAACTTACTATAGGGCAGATGATGAATTTC
TATAA
 Primer design