SecReT4
Protein ID: 73746044
T4SS name [ID]Trb [70]
Gene symboltrbC
Locus tagpA1_36
StrainSphingomonas sp. A1 plasmid pA1 (NC_007353)
Repliconplasmid pA1 [GenBank: NC_007353] [Browse all T4SS(s) in this replicon]
Location [Strand]34683..35147 [+]
ProductTrbC
Component typeTrbC
UniProt IDQ4AC53
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 4e-18, Aligned region: 17..110
Protein Sequence: 154 a.a.     [Download]
>gi|73746044|ref|YP_302636.1| TrbC [Sphingomonas sp. A1]
MQSTLPAFRFDSRAVFYLGMFALLAFFLLAPQHAFASEGTGGSLPYEGWLTNLRNSVTGPVAFALSIIGI
VVAGGILIFGGELNGFFRTLIFIVLVMALLVGAQNMMSTFFGRGAEIAALTDGVLHQAKVAALDMAGFPG
EAVARWAERGHIAG
 
Nucleotide Sequence: 465 bp     [Download]
>gi|89142220|ref|NC_007353.2|:34683-35147 Sphingomonas sp. A1 plasmid pA1 DNA, complete sequence
ATGCAATCGACCCTTCCCGCGTTCCGCTTCGACAGCCGCGCCGTGTTCTACCTGGGCATGTTTGCCCTCT
TGGCGTTCTTCCTGCTGGCACCCCAGCACGCTTTCGCCTCCGAAGGCACCGGCGGTTCGCTGCCGTATGA
AGGCTGGTTGACCAACCTGCGAAACAGCGTCACCGGCCCGGTGGCCTTCGCGCTGTCGATCATCGGCATC
GTCGTCGCCGGCGGCATCTTGATCTTCGGCGGCGAACTCAACGGCTTCTTCCGCACGTTGATCTTCATCG
TCCTGGTCATGGCCCTGCTGGTCGGTGCGCAGAACATGATGAGCACCTTCTTCGGCCGTGGCGCGGAAAT
CGCCGCCCTGACCGATGGCGTGCTGCACCAGGCCAAGGTCGCGGCGCTGGACATGGCCGGCTTCCCTGGT
GAAGCCGTCGCACGCTGGGCCGAGCGCGGCCACATCGCGGGGTAA
 Primer design