SecReT4
Protein ID: 73746048
T4SS name [ID]Trb [70]
Gene symboltrbG
Locus tagpA1_40
StrainSphingomonas sp. A1 plasmid pA1 (NC_007353)
Repliconplasmid pA1 [GenBank: NC_007353] [Browse all T4SS(s) in this replicon]
Location [Strand]38799..39713 [+]
ProductTrbG
Component typeTrbG
UniProt IDQ4AC49
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 3.4e-64, Aligned region: 79..303
Protein Sequence: 304 a.a.     [Download]
>gi|73746048|ref|YP_302640.1| TrbG [Sphingomonas sp. A1]
MNPRTFTMKKTLLVATLGAALLSPSLALAADDLADKYFTGKNPTLTPQERAAIDIAKRWNAGAATGMRPV
AGSNGAIKFLFGAQQPSIVCAVLQVCDVALQPGEQVNSINLGDTARWTVEPAITGSGPNEVQHLIIKPMD
VGLETSLIVTTNRRAYHLRLRSHRSEYMPQVSFTYPEDALAKWDAIQRRETQERTDSTIPQTGEYLGDLK
FDYDLSGSASWKPVRVYNDGRKTIIEMPGTMEQTEAPTLLVVRREGGLFRDEETVMVNYRVQGNRYIVDT
VFDRAILIAGVGGSQDRVTINRRK
 
Nucleotide Sequence: 915 bp     [Download]
>gi|89142220|ref|NC_007353.2|:38799-39713 Sphingomonas sp. A1 plasmid pA1 DNA, complete sequence
ATGAACCCGAGGACATTCACCATGAAGAAAACCCTTCTCGTTGCCACCTTGGGCGCTGCGCTGCTGTCGC
CCTCTCTGGCCCTGGCCGCCGACGACCTGGCGGACAAGTATTTCACCGGCAAGAACCCGACCCTGACGCC
TCAAGAGCGTGCCGCCATCGACATTGCGAAGCGGTGGAACGCGGGCGCGGCCACCGGCATGAGGCCCGTC
GCCGGCTCCAATGGCGCGATCAAGTTCCTGTTCGGCGCGCAGCAGCCCAGCATCGTGTGCGCGGTGCTCC
AGGTGTGCGACGTGGCCTTGCAGCCAGGCGAGCAAGTCAACTCGATCAACCTGGGCGACACGGCCCGGTG
GACGGTCGAGCCGGCCATCACCGGCAGCGGCCCCAACGAAGTGCAGCACCTCATCATCAAGCCGATGGAT
GTTGGCCTGGAAACCAGCCTCATCGTGACGACGAACCGCCGCGCCTATCACCTGCGCCTGCGCTCGCATC
GCAGCGAGTACATGCCGCAAGTCTCGTTCACGTACCCCGAGGACGCGCTTGCGAAGTGGGACGCGATCCA
GCGCCGTGAAACGCAGGAGCGCACCGACAGCACCATCCCGCAGACCGGCGAGTACCTGGGCGATCTCAAG
TTCGACTATGACCTGTCCGGCTCGGCGAGCTGGAAGCCGGTGCGTGTGTACAACGATGGCCGCAAGACCA
TCATCGAAATGCCCGGAACGATGGAGCAAACCGAAGCGCCGACGCTTCTGGTGGTGCGCCGCGAGGGTGG
CCTGTTCCGCGACGAGGAAACCGTGATGGTGAACTACCGCGTGCAGGGCAATCGCTACATCGTGGACACG
GTTTTCGACCGCGCGATCCTGATTGCCGGTGTCGGCGGAAGCCAAGACCGCGTGACGATCAACCGGAGGA
AGTGA
 Primer design