SecReT4
Protein ID: 73746053
T4SS name [ID]Trb [70]
Gene symboltrbL
Locus tagpA1_45
StrainSphingomonas sp. A1 plasmid pA1 (NC_007353)
Repliconplasmid pA1 [GenBank: NC_007353] [Browse all T4SS(s) in this replicon]
Location [Strand]42594..44330 [+]
ProductTrbL
Component typeTrbL
UniProt IDQ4AC44
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1.3e-39, Aligned region: 65..279
Protein Sequence: 578 a.a.     [Download]
>gi|73746053|ref|YP_302645.1| TrbL [Sphingomonas sp. A1]
MRMPASLKLALPLLVWLAFFSTNAYAQALDSAGLFDDVLNRYNAAASGWAGVITDAASWLFWTLVVISMV
WTFGMMALRKADIGEFFAELVRFTIFTGFFWWLLTNGPNFASTIYASLRQVAGNATGLGNALSPSGIVDV
GFAIFYKVMDQSSVWSPVDSMAGILMAVAILVVLALIGVNMLLLLASGWVLAYGGVFFLGFGGSRWTSDM
AINYYKTVLGVAAQLMAMVLLVGIGKTFLDDYYARMSAGINLKEMGVMLIVCVILLALVNKIPALIAGII
TGASVGGAGIGNFGAGAALGAAGMAAAAAATGGAALAAGAASAAGGASAVMAAFSKANENVSSGSDVMSM
LGGGGGGGGDSGGGGGDAGTSTPLGQAAGFGGGGGGDSGGGGSSGGGESKGGDKGSDKAGGDKGGSSSKG
GEGGGQKASGGGDAGGAKAGQGGGQQGQGAGQGGQQDAPGSTGPGMLASAASALGKAGRVTADAGANLAK
GVGAVAAAKAASMRDSAMERIADTTGGKIAAAIKAQGTSSADAGTDAPDQQPSPTFGDNSLAGATSADPE
SEVAAFANRDGDRSDKSA
 
Nucleotide Sequence: 1737 bp     [Download]
>gi|89142220|ref|NC_007353.2|:42594-44330 Sphingomonas sp. A1 plasmid pA1 DNA, complete sequence
ATGAGAATGCCAGCCAGTTTGAAACTCGCCTTGCCGCTGCTCGTTTGGCTGGCGTTCTTTTCCACGAACG
CTTATGCCCAAGCATTGGACAGCGCGGGCCTCTTCGATGACGTTCTGAACCGCTACAACGCCGCCGCCAG
CGGCTGGGCCGGGGTCATCACCGATGCGGCGTCCTGGTTGTTCTGGACGTTGGTCGTGATCTCGATGGTC
TGGACGTTCGGCATGATGGCCTTGCGCAAGGCCGACATTGGCGAGTTCTTCGCGGAGCTTGTCCGCTTCA
CCATCTTCACCGGCTTCTTTTGGTGGTTGCTGACGAACGGGCCGAACTTCGCTTCAACGATCTATGCGTC
GCTGCGCCAGGTGGCCGGCAACGCGACCGGCCTGGGCAATGCCCTGTCTCCATCGGGCATTGTCGATGTG
GGCTTTGCCATCTTCTACAAGGTGATGGATCAGTCCTCGGTGTGGTCGCCGGTGGACAGCATGGCCGGCA
TCCTCATGGCGGTGGCCATCCTGGTCGTGCTCGCCCTCATCGGCGTGAACATGCTTCTTCTCCTGGCGTC
CGGCTGGGTGCTCGCCTATGGCGGCGTGTTCTTCCTCGGCTTCGGTGGAAGCCGTTGGACTTCCGACATG
GCGATCAACTACTACAAGACCGTGCTGGGCGTGGCCGCGCAGCTCATGGCGATGGTGCTCCTGGTCGGCA
TCGGCAAGACCTTCCTGGACGACTACTACGCGCGCATGAGCGCCGGGATCAACCTCAAGGAAATGGGCGT
GATGCTCATCGTCTGCGTGATCCTGCTGGCCCTGGTCAACAAGATTCCGGCGCTCATCGCCGGGATCATC
ACCGGCGCGAGCGTGGGCGGTGCAGGCATCGGCAACTTCGGTGCAGGCGCGGCCCTCGGTGCTGCCGGCA
TGGCGGCCGCAGCAGCGGCCACCGGCGGCGCTGCTCTCGCGGCCGGCGCGGCTTCGGCCGCCGGCGGTGC
TTCGGCGGTCATGGCCGCGTTCTCGAAGGCCAATGAAAACGTCTCGTCCGGGTCGGATGTCATGTCCATG
CTGGGCGGCGGCGGCGGTGGTGGTGGCGACTCGGGCGGTGGTGGCGGCGATGCCGGCACCAGCACGCCCC
TGGGCCAAGCTGCCGGCTTTGGTGGTGGCGGCGGTGGCGACTCGGGCGGCGGCGGCAGTAGCGGCGGCGG
CGAGTCGAAGGGCGGCGACAAGGGCAGTGATAAGGCCGGCGGCGACAAGGGCGGCTCCAGCTCGAAGGGT
GGCGAAGGCGGCGGCCAGAAGGCCAGCGGCGGCGGTGACGCCGGCGGCGCGAAGGCCGGCCAGGGTGGCG
GCCAGCAGGGCCAGGGAGCGGGGCAGGGCGGCCAGCAGGACGCACCTGGTAGCACCGGCCCCGGCATGCT
GGCCTCGGCCGCTTCGGCGCTCGGCAAAGCCGGTCGTGTTACGGCCGACGCCGGCGCGAACTTGGCGAAG
GGCGTGGGTGCGGTGGCGGCCGCCAAGGCAGCAAGCATGCGCGACTCGGCGATGGAACGCATCGCCGACA
CCACCGGCGGAAAGATCGCAGCCGCCATCAAGGCGCAGGGCACCAGCTCGGCCGACGCCGGCACCGACGC
GCCGGATCAACAACCCTCGCCGACCTTCGGCGACAACAGCCTGGCAGGCGCTACCTCTGCCGATCCCGAG
TCCGAAGTGGCCGCATTCGCTAACCGCGACGGCGACCGCAGCGACAAATCCGCTTAA
 Primer design