SecReT4
Protein ID: 73853199
T4SS name [ID]Tra_I [172]
Gene symboltraJ
Locus tagLH0024
StrainEscherichia coli plasmid pO113 (NC_007365)
Repliconplasmid pO113 [GenBank: NC_007365] [Browse all T4SS(s) in this replicon]
Location [Strand]21024..22172 [+]
ProductATP-binding protein
Component typeTraJ_I
UniProt IDQ7WUE8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 4.5e-33, Aligned region: 142..292
AAA_25 [PF13481], Evalue: 6.9e-05, Aligned region: 146..197
Protein Sequence: 382 a.a.     [Download]
>gi|73853199|ref|YP_308695.1| ATP-binding protein [Escherichia coli]
MISPDDFGTFPFSRFTAEEFRHFFAWCARHRVSDIDLTGGSPVSVSRFGRRVRSSVNPLPSSIMMALSDE
LFGREVLPRVLSGHPVDRTIQVSGDASGRYGLQRGQRVRLRCHLIQGTSATEEKAISVTMRVIPSDIPDI
LTMNIEPDLLDAMLRKTGLGFICGETGSGKSTLAAALYRHILKNFPDRKIVTYEDPVEYILGGENDLLPP
HQAEIGRDVESFAAGLRSAVRRNPDIIGIGEIRDYETADAAVQAGNTGHFCIGTMHTKSPGETFARLLGL
FPPEIRDSMAAATLSLVQFILVQVLVRTNDGGRQAVREYIVMTDELRNTLSGQSHATWGHYIDEIIRQEK
RRIRDQVLTMYQNDRIEKSEAALFIPAGEFPR
 
Nucleotide Sequence: 1149 bp     [Download]
>gi|73853177|ref|NC_007365.1|:21024-22172 Escherichia coli EH41 plasmid pO113, complete sequence
ATGATATCACCAGATGACTTCGGTACCTTCCCCTTCTCCCGTTTTACGGCAGAAGAGTTTCGCCATTTTT
TTGCCTGGTGTGCCCGCCACCGCGTCAGTGATATTGATCTGACCGGCGGCTCACCGGTATCCGTCAGTCG
CTTTGGACGGCGGGTTCGCTCATCCGTAAATCCCCTTCCGTCTTCCATCATGATGGCACTGAGTGATGAG
CTGTTTGGGCGGGAGGTTCTTCCCCGGGTTCTGTCAGGTCATCCCGTGGATCGTACCATTCAGGTCAGCG
GAGATGCCTCCGGCCGCTATGGCCTGCAGCGAGGTCAGCGTGTTCGCCTGCGCTGCCACCTGATACAGGG
AACATCGGCAACAGAAGAAAAAGCCATTTCCGTCACCATGCGGGTGATCCCGTCAGATATTCCGGACATC
CTCACTATGAATATTGAACCGGATCTGCTAGATGCCATGCTCAGAAAAACCGGCCTGGGCTTCATCTGCG
GAGAAACCGGCTCCGGGAAATCCACACTGGCGGCGGCACTGTATCGCCACATTCTGAAAAATTTCCCCGA
TCGCAAAATAGTGACCTATGAAGATCCGGTGGAATACATTCTGGGCGGAGAGAATGACCTTCTGCCTCCC
CATCAGGCCGAAATCGGGCGCGATGTGGAAAGTTTTGCTGCAGGACTTCGCTCTGCCGTTCGCCGTAATC
CGGACATCATTGGTATCGGTGAAATCAGGGATTATGAAACAGCAGATGCCGCAGTCCAGGCGGGTAATAC
CGGACACTTTTGTATCGGCACCATGCACACAAAATCACCCGGAGAAACCTTTGCCCGCCTGCTGGGATTG
TTTCCTCCTGAAATCAGAGATTCGATGGCTGCAGCCACGCTTTCCCTCGTACAGTTCATTCTGGTGCAGG
TACTGGTCAGAACAAATGACGGCGGCAGGCAGGCTGTCCGGGAATACATCGTCATGACTGACGAACTGCG
CAATACGCTCTCCGGACAATCCCATGCAACATGGGGACATTACATTGACGAAATCATTCGTCAGGAAAAA
CGGCGGATAAGGGATCAGGTTCTGACCATGTATCAGAACGACCGCATTGAGAAATCAGAAGCAGCGCTCT
TCATCCCGGCCGGAGAGTTCCCCCGATGA
 Primer design