SecReT4
Protein ID: 73853202
T4SS name [ID]Tra_I [172]
Gene symboltraL
Locus tagLH0027
StrainEscherichia coli plasmid pO113 (NC_007365)
Repliconplasmid pO113 [GenBank: NC_007365] [Browse all T4SS(s) in this replicon]
Location [Strand]26556..26906 [+]
Producthypothetical protein
Component typeTraL_I
UniProt IDQ7WUE5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 116 a.a.     [Download]
>gi|73853202|ref|YP_308698.1| hypothetical protein LH0027 [Escherichia coli]
MNMKKTLLVILTSISLASPAAVAATCRAGAAAEAGSKAAWERARTASQAWSQRENDVASSLQSCLSRIKD
VSITLPQFPSLDKILRDLENQVCDAVVDRVNEHLPGNIDPWKDYNL
 
Nucleotide Sequence: 351 bp     [Download]
>gi|73853177|ref|NC_007365.1|:26556-26906 Escherichia coli EH41 plasmid pO113, complete sequence
ATGAACATGAAAAAAACGCTGCTGGTCATACTGACCAGCATCTCGCTGGCTTCTCCGGCTGCCGTGGCAG
CAACCTGTCGGGCAGGTGCTGCCGCAGAAGCCGGCAGCAAAGCCGCCTGGGAGCGGGCGCGTACAGCCAG
CCAGGCATGGTCACAGCGAGAAAACGACGTCGCCTCCTCCCTGCAGTCCTGCCTGTCCCGCATTAAGGAC
GTCAGCATCACTCTTCCACAATTCCCCAGCCTGGACAAAATCCTTCGCGATCTGGAAAACCAGGTCTGTG
ATGCCGTCGTGGATCGGGTGAATGAACATCTGCCGGGGAATATCGACCCCTGGAAAGACTATAACCTCTG
A
 Primer design