SecReT4
Protein ID: 73853203
T4SS name [ID]Tra_I [172]
Gene symboltraM
Locus tagLH0028
StrainEscherichia coli plasmid pO113 (NC_007365)
Repliconplasmid pO113 [GenBank: NC_007365] [Browse all T4SS(s) in this replicon]
Location [Strand]26918..27613 [+]
Producthypothetical protein
Component typeTraM_I
UniProt IDQ7WUE4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam IcmL [PF11393], Evalue: 6.8e-34, Aligned region: 78..185
Protein Sequence: 231 a.a.     [Download]
>gi|73853203|ref|YP_308699.1| hypothetical protein LH0028 [Escherichia coli]
MSEAHPTSPVSPETDNSGDIYKQTLSTIAQSEQRAALVPGLVRALLCSSAALVISLTGNIIQCWHNSNVT
REYFATDNGRLVRLAPTSQPAWSQSDVMTFGSMTLSEAFNLDFVHYRKQITTLAPRFSEAGFAGYVNALQ
ASNILDTIKKEKFNLTATIGAGTLVNQGQMENGIWFWKFQYPVRMRLVGQTSTRPEQAFTFEITVRRVDP
RIKPGGMEISQMVSRNAASGT
 
Nucleotide Sequence: 696 bp     [Download]
>gi|73853177|ref|NC_007365.1|:26918-27613 Escherichia coli EH41 plasmid pO113, complete sequence
ATGAGCGAAGCACACCCCACATCCCCTGTCTCTCCGGAAACAGATAACAGCGGAGATATTTATAAACAAA
CGCTCAGTACCATTGCACAGTCAGAACAACGGGCCGCACTGGTTCCCGGACTGGTCAGGGCCTTGCTGTG
TAGCAGCGCAGCTCTCGTCATCAGTCTGACCGGCAATATCATACAGTGCTGGCATAACAGCAACGTAACG
CGTGAATACTTTGCCACCGACAATGGCCGGCTGGTCCGCCTGGCCCCCACCAGTCAGCCAGCCTGGAGTC
AGAGCGACGTCATGACGTTTGGCAGCATGACGCTGAGCGAAGCTTTTAATCTGGATTTTGTCCACTACAG
GAAACAAATCACGACACTGGCCCCCCGCTTTTCCGAAGCCGGCTTTGCCGGCTATGTGAATGCTCTTCAG
GCCTCCAACATTCTGGACACCATTAAAAAGGAGAAATTTAACCTCACGGCCACCATCGGGGCCGGCACGC
TGGTGAATCAGGGCCAGATGGAAAACGGCATCTGGTTCTGGAAATTCCAGTATCCGGTCAGGATGCGTCT
GGTCGGTCAGACCAGCACCCGCCCCGAGCAGGCCTTCACCTTTGAAATCACTGTCCGGCGCGTTGACCCA
CGAATCAAACCCGGCGGCATGGAAATCAGCCAGATGGTTTCCCGTAACGCCGCATCAGGAACCTGA
 Primer design