SecReT4
Protein ID: 73853213
T4SS name [ID]Tra_I [172]
Gene symboltraU
Locus tagLH0038
StrainEscherichia coli plasmid pO113 (NC_007365)
Repliconplasmid pO113 [GenBank: NC_007365] [Browse all T4SS(s) in this replicon]
Location [Strand]33625..36669 [+]
Productnucleotide-binding protein
Component typeTraU_I
UniProt IDQ7WUD4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 1.8e-42, Aligned region: 502..898
Protein Sequence: 1014 a.a.     [Download]
>gi|73853213|ref|YP_308709.1| nucleotide-binding protein [Escherichia coli]
MNINRIIFAIEDCISTLSRYSVSAFFPDYCDLHTVIGLDQQDRERRPWLKAPYIATTKQGYYLSVFEISG
ALKEMDENPDLTAPGTLESLITALAERMNTAYKNTGHKISFVFERDPERGRDEIEAMLLPQRKSIARTGI
LLQDVLDEKVTTLTPWLVRERCWLTVWSSEELLSRTDRKDHQTRIRKLAEHAPPARFAQDPWRWTLSALK
IRHDAFLDTLEQALTHDSDGLLVRLMDIHEVGREIRRQLERNSTPAVWQPHLPEDARPAGWRQGEDTSVF
HAPSLNLQLFTTQPETHGSLIKAGDLWHGMVAITLPPQNLRTFNQLVRDVPRAIPWRIRMDLMPGGMKAL
GVKKNLLTYSSFISPLRPMYDSVMMLNDINKHDPVCIMTIVATTWGNSREVCTRNQALLKSALEGWGVCG
TTTTFGDPRRAWVNTVLAASHGSGPVPLYPPLSHALSLFPLNRAGSVWRGQGNLMMHTEDGSAWEVALAS
SQQNKHTELTPGAPGLGKSVLINALSEIQIASAQKNLPFIAYIDKGFSAQGLVQLIRDSLPEQRKDEAVG
IILSNDPEHTRNLFDVMYGAKKPATPEKNFMVSVLCALCVDTGTGQPCNPGDIRQIISNLVDLAFREYGE
NNPRLYRAGTESLVDLALEESGIAEQHDAGWWNAATWFEIRDMLHMAGNIPAAQRAHYQAMPLLAEMSAL
LGQPSIRDVFGTVQRDNSAELLLDYIRRALDQGHSDYPMMSGCTRFMLSPDTRVVAVDLNNVAGDKTPAG
RLRTGIMYLLAGQIAGGDFVLPQYQEEIRKNLDPRYHEVIFRRIEQLDQEVKTKVYDELHNAKGINFIWE
ALDTQELEQRKFGIRTVLSTQLLQDYPPAVLKSANTLWLLRYRPDEIPFLRDNFGVPEVTLRRFLKMPEG
AAPDGSGVPVLAVFRVKNGTLARILKFTLGPLELWALNSSPKDSALRRALTQELGSLRARQILAENFPRG
SATSLIEHRARTHDSENVIHDLAAELIRKQGYHL
 
Nucleotide Sequence: 3045 bp     [Download]
>gi|73853177|ref|NC_007365.1|:33625-36669 Escherichia coli EH41 plasmid pO113, complete sequence
ATGAATATCAACCGCATTATTTTTGCCATTGAAGACTGTATCAGTACCCTGTCACGGTATTCCGTTTCCG
CATTCTTCCCCGATTACTGTGATCTGCACACCGTCATCGGTCTGGACCAACAGGACCGCGAACGCCGCCC
CTGGCTGAAAGCCCCCTACATTGCCACCACCAAACAGGGGTATTACCTTTCCGTCTTTGAAATCAGCGGT
GCCCTGAAAGAAATGGATGAAAACCCGGACCTGACAGCCCCCGGCACACTGGAATCACTGATTACAGCGC
TGGCCGAGCGAATGAACACTGCCTATAAAAACACCGGTCACAAAATCAGTTTTGTTTTCGAACGCGATCC
GGAGCGTGGAAGGGATGAAATCGAAGCCATGCTCTTACCCCAGCGAAAATCCATCGCACGCACGGGGATC
CTGCTTCAGGACGTTCTGGATGAAAAAGTCACTACACTCACCCCCTGGCTTGTCCGGGAACGCTGCTGGC
TGACCGTCTGGAGCTCTGAAGAACTGCTGAGCCGGACCGATCGCAAGGACCACCAGACCCGTATCAGGAA
ACTCGCTGAACACGCTCCGCCAGCCCGATTTGCGCAGGATCCATGGCGCTGGACACTTTCCGCACTCAAA
ATACGGCATGACGCCTTTCTGGACACGCTGGAGCAGGCCCTGACACATGATTCTGATGGTCTGCTGGTTC
GCCTGATGGATATTCATGAAGTGGGACGGGAAATCCGCCGTCAACTGGAGCGCAACAGCACACCTGCAGT
ATGGCAGCCTCATCTGCCTGAAGATGCCCGTCCTGCCGGCTGGCGACAGGGCGAGGATACCTCTGTATTC
CACGCACCGTCGCTGAATCTGCAGTTATTCACCACACAGCCTGAAACACACGGCAGCCTGATAAAGGCCG
GTGACCTCTGGCACGGTATGGTCGCCATTACCCTGCCCCCCCAGAATCTGCGGACATTCAACCAGCTGGT
CAGGGATGTGCCCCGCGCAATCCCCTGGCGTATCCGGATGGATCTGATGCCCGGCGGCATGAAGGCGCTT
GGGGTCAAGAAAAACCTGCTGACCTACAGCAGCTTTATTTCCCCTCTCCGGCCCATGTATGACTCGGTGA
TGATGCTGAATGACATCAACAAACATGATCCGGTCTGTATCATGACCATTGTTGCCACCACATGGGGAAA
CAGCCGGGAAGTCTGTACCCGCAACCAGGCTCTCCTGAAATCTGCGCTGGAAGGCTGGGGAGTATGCGGC
ACCACCACCACCTTCGGTGATCCGAGACGTGCCTGGGTGAACACGGTTCTGGCGGCCTCCCACGGTTCCG
GTCCAGTCCCCCTTTACCCGCCCCTTTCACACGCCCTTTCCCTGTTTCCCCTGAACAGGGCCGGCTCTGT
CTGGCGGGGACAGGGAAATCTGATGATGCACACCGAAGACGGCTCTGCATGGGAGGTCGCGCTGGCATCG
TCACAACAGAACAAGCACACGGAACTGACGCCCGGCGCACCCGGTCTGGGCAAATCGGTACTCATCAACG
CACTGTCGGAGATCCAGATAGCCTCAGCCCAGAAGAACCTGCCTTTCATTGCCTATATCGACAAGGGATT
CAGTGCACAGGGACTGGTACAGCTTATCCGTGACAGCCTGCCGGAGCAGAGAAAGGACGAAGCCGTGGGG
ATCATTCTGAGCAATGATCCGGAACACACCCGTAACCTGTTTGATGTGATGTACGGTGCTAAAAAACCCG
CCACCCCGGAAAAGAACTTCATGGTATCTGTACTCTGCGCACTGTGCGTGGATACCGGCACCGGTCAGCC
CTGTAATCCCGGTGACATCCGGCAAATCATAAGCAACCTGGTGGATCTGGCCTTCAGGGAGTATGGCGAA
AACAACCCCAGACTGTACCGTGCAGGAACAGAGTCCCTTGTGGATCTCGCCCTGGAAGAGAGTGGCATCG
CAGAACAACATGACGCTGGATGGTGGAATGCTGCCACCTGGTTTGAAATCAGGGACATGCTGCATATGGC
TGGCAATATCCCCGCAGCCCAGCGGGCACACTACCAGGCCATGCCCCTGCTGGCTGAAATGTCCGCCCTG
CTGGGACAGCCATCCATCCGGGATGTGTTCGGCACAGTTCAGCGCGATAACTCAGCAGAATTGTTACTGG
ACTACATCCGCCGTGCCCTCGATCAGGGACACAGTGACTACCCGATGATGTCCGGCTGTACCCGGTTTAT
GCTCAGCCCCGACACCCGCGTCGTGGCCGTTGATCTGAACAATGTGGCCGGTGACAAGACACCTGCCGGG
CGTCTGCGCACCGGCATCATGTACCTGCTGGCAGGACAAATCGCCGGCGGGGATTTTGTCCTGCCGCAGT
ATCAGGAGGAAATACGGAAAAATCTCGACCCACGCTACCATGAGGTGATTTTCCGCCGCATTGAACAGCT
TGATCAGGAGGTCAAGACCAAAGTCTATGACGAACTGCACAATGCAAAAGGGATCAATTTCATCTGGGAA
GCCCTAGACACCCAGGAGCTGGAGCAGCGTAAGTTCGGGATACGCACAGTGCTGAGCACCCAGCTACTGC
AGGACTATCCACCGGCAGTTCTCAAATCCGCCAACACCCTCTGGTTGCTGCGTTACCGCCCTGACGAAAT
TCCGTTTCTGCGGGATAATTTTGGTGTCCCTGAAGTCACCCTGCGGCGCTTTCTGAAAATGCCGGAAGGG
GCTGCACCGGATGGCAGCGGTGTCCCGGTACTGGCTGTGTTCCGTGTAAAGAACGGTACGCTGGCCCGGA
TCCTGAAATTCACTCTCGGTCCACTGGAGCTGTGGGCACTGAATTCCTCACCCAAAGACAGCGCCCTGAG
ACGTGCGCTGACGCAGGAGCTCGGGTCACTGCGGGCACGCCAGATCCTGGCAGAAAACTTTCCCCGTGGT
TCAGCCACCTCACTGATAGAACACCGCGCCCGTACACATGACAGTGAAAACGTCATCCATGATCTGGCTG
CAGAACTCATCCGTAAGCAGGGATATCACCTCTGA
 Primer design