SecReT4
Protein ID: 77164154
T4SS name [ID]Tfc [702]
Gene symbol-
Locus tagNoc_0630
StrainNitrosococcus oceani ATCC 19707
Repliconchromosome [GenBank: NC_007484] [Browse all T4SS(s) in this replicon]
Location [Strand]677299..677862 [+]
Productlytic transglycosylase, catalytic
Component typeTfc4
UniProt IDQ3JDE7
KEGG IDnoc:Noc_0630
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 187 a.a.     [Download]
>gi|77164154|ref|YP_342679.1| lytic transglycosylase, catalytic [Nitrosococcus oceani ATCC 19707]
MARRLITVCFVGVLWWSTPAQSESVPVGYKKVASEYGLPPALLYSVALTESGQSSLSEGQFRPWPWALNI
DGEGHYFSSRQLAWHALQAALTETEASSVDVGLMQISWRYHRANLGSSWQALDPYHNLRVAAAILRDCFV
EHTHWIQSAGCYHAPNDPARADLYGQRVKAHWMRLTDTPTEVHLEYP
 
Nucleotide Sequence: 564 bp     [Download]
>gi|77163561|ref|NC_007484.1|:677299-677862 Nitrosococcus oceani ATCC 19707 chromosome, complete genome
ATGGCACGCCGGTTAATCACGGTCTGCTTTGTCGGCGTTCTGTGGTGGTCGACACCCGCGCAGTCAGAAT
CTGTGCCGGTGGGATATAAGAAAGTCGCGAGTGAATACGGTCTTCCTCCTGCCTTGCTCTATTCGGTAGC
CCTGACCGAAAGTGGGCAAAGCTCGCTTAGCGAAGGACAGTTTCGACCCTGGCCGTGGGCACTCAATATC
GACGGTGAAGGACACTATTTCTCGTCACGTCAGCTGGCATGGCATGCCCTGCAGGCGGCGTTAACGGAAA
CGGAAGCCTCGTCGGTGGATGTCGGTCTGATGCAAATCAGTTGGCGCTACCATCGGGCAAACTTGGGCTC
ATCCTGGCAGGCGCTGGATCCCTACCACAACTTGCGAGTAGCCGCCGCGATCCTGCGCGACTGCTTCGTC
GAACACACCCACTGGATTCAAAGCGCCGGCTGCTATCACGCACCGAATGATCCTGCCCGAGCTGACCTCT
ATGGTCAGCGGGTCAAGGCGCACTGGATGCGGTTGACCGATACACCAACGGAGGTGCACCTTGAGTATCC
GTAA
 Primer design