SecReT4
Protein ID: 77164157
T4SS name [ID]Tfc [702]
Gene symbol-
Locus tagNoc_0633
StrainNitrosococcus oceani ATCC 19707
Repliconchromosome [GenBank: NC_007484] [Browse all T4SS(s) in this replicon]
Location [Strand]680571..681302 [+]
Producthypothetical protein
Component typeTfc8
UniProt IDQ3JDE4
KEGG IDnoc:Noc_0633
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 3.5e-63, Aligned region: 44..240
Protein Sequence: 243 a.a.     [Download]
>gi|77164157|ref|YP_342682.1| hypothetical protein Noc_0633 [Nitrosococcus oceani ATCC 19707]
MAEPTDPRRPVTRPGTFSRVLTGLAQCLKWLFLSLIFSVLIEWIGMVFWWEEQGLDHSRQMLVNELQFLG
ADFHRSWLTAHPMQFASDLSDRFYHIAFEWTGIVDLIQWITPAPGLEESGVRPVLHRFYRPVADYVLAGM
QITQVFAVRLAILTLATPVFGLFTLVALVDGLVRRDLRRWGGGRESSFVYHYAKKAAIPLIIMAWVLYLA
LPFSLHPSWIILPFALAFAFAVTITASTFKKYL
 
Nucleotide Sequence: 732 bp     [Download]
>gi|77163561|ref|NC_007484.1|:680571-681302 Nitrosococcus oceani ATCC 19707 chromosome, complete genome
ATGGCGGAACCGACGGATCCCCGCCGACCCGTCACGCGCCCCGGCACATTCTCCCGGGTTTTGACAGGGC
TAGCCCAGTGTCTTAAGTGGCTGTTTCTCTCACTGATATTTTCCGTTCTGATTGAATGGATCGGCATGGT
GTTCTGGTGGGAGGAGCAGGGGCTGGATCACAGCCGACAGATGCTGGTGAACGAGTTGCAGTTCCTCGGC
GCAGACTTTCACCGCAGCTGGTTAACGGCTCATCCCATGCAATTCGCCAGTGATTTGTCCGACCGGTTTT
ACCATATCGCCTTTGAGTGGACCGGTATTGTCGATCTTATCCAGTGGATTACGCCGGCCCCGGGCCTTGA
AGAGTCCGGCGTGCGCCCGGTGCTGCACCGGTTTTACCGGCCAGTTGCTGACTATGTCCTGGCCGGTATG
CAAATCACGCAGGTTTTTGCGGTACGTCTCGCCATCCTGACGCTGGCGACGCCGGTATTTGGACTGTTCA
CCCTGGTGGCACTGGTTGATGGTCTGGTGCGGCGGGACCTGCGGCGTTGGGGCGGCGGCAGGGAAAGCTC
TTTCGTCTATCACTATGCCAAGAAAGCCGCCATACCGCTGATCATCATGGCCTGGGTGCTGTACCTGGCG
CTACCGTTCAGTTTGCACCCGTCCTGGATCATCTTGCCGTTCGCTCTGGCCTTTGCCTTTGCTGTGACCA
TCACGGCCAGTACCTTCAAAAAGTATCTCTGA
 Primer design